SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16649
Pre Gene Modal
BGIBMGA002210
Annotation
PREDICTED:_uncharacterized_protein_LOC101737771_isoform_X3_[Bombyx_mori]
Transcription factor
Location in the cell
Nuclear   Reliability : 3.105
 

Sequence

CDS
ATGCCTGATACTCATCGTACTTGTGAAGTTTGTGGTATCAAAGAAAGACATCTTACTGAAAAACGGTTTTTCGCAAGGTTTCCTCTGGATGTCAATAGATGTAAACAATGGGTAAAGATGGTTGGCAAAGAAGATCTGGCTTATCTTCAAGTACATATGCTACATGATTTAAAACATGTTTGTGAAGCACATTTCTCAAGACGAGACTTTACAAAATCAAAGAAGCGCTTAAAAAAACGAGCTGTACCCAAACTGAACTTGACACTGCCACCATTGAGAGATGAAATTCTTCTTCAATTTTTGCAACTCAACTCGCAAGCGGATGTCACCCCACAAGGCCAGTTCGAGGTTCAGGCCGTTCCTAGTGCTTTGATGCCAGCATCCTCAAGTCAGCCTAGCGGTCTAGAGAAAACTGATGTCACCCCACAAGGCCAGTTTGAGGTTCAGGCTGTTCCTTGTACTTCAATGCCAACATCCTCAAGTCAGTCTAGCAGTCTAGAGAAAAACGTCACCAAAGGAAGCCAGCGGAAAGAAAGTGAAAGTCAAATAAGAAAAAGAAAATTAGAAGATGTTGATGTTACACCACGGAAAAGGAAGCTCTTAAGTGAATTGAGAAAAACAAAGTGCACATTGGCATCATTAAAAAAGAGCGCGAAACTAATAGACAATTTATCGTCAGAGTTTCTAAAAGAAATTGTCACGTCTGCGTTGATAAATCAAAAGCGTAAGTCACAAGGCAAACGCTGGACTATTAAAAATAAAATATCAGCATTAGCCATCTTCAAGCGTTCACCAAAAGCTTACCGATATCTGCGATATCTCGCACCATTTCCGAGTATCAAAACATTGCAAAAATTAATGAAAAAAATACCTGTTGAGCCAGGTTTAAATACAGCTGTACTTGACCACCTGAAAAAACTAGCTCCCATTAAAAAAATAAGAGCAAAATTATGTTCGCTAGTCTTTGATGAAATAGCGTTAAAAGAAAGGTTAACTTATAGCGAAGCCACAGATAAAGTGGAAGGGTTTATCGATTATGGATATGAGAGGAAAGATGAGCTAGCAAATCATGCCTTAGTCTTCATGTTACAAGGTATTGGGAGAAAAATTAAACAACCGCTGGCATTCTATTTCATAAGAGGCACAGTATCTTCAGAAAAATTAGCAGTTTTAATAAAAGATATAATTAAAGAAATTACTAACTCGGGATTTCAAGTTTTATCAACAATATGTGATCAAGCGCCCACCAATATGGGAGCATTAAGTCTGTTAAAGGAGTGGAACAATGGTGGACATAATTATTTTGAATTTGAAAATAAAAAAATTTATATAATTTATGATATTCCACATTTATTAAAATCACTGAGAAATAACTTTTTAAAACAAGGATTTCTGAAAATGGGAGAATTGAAAGGTCAATGGAGCCATTTAGTTGAGGTAGAGGAACGAAATAGAAATTTTTTATATCTTAGCAAACTCAAATCAACTCATGTACAACCAAAGTACAGAGCTAAAATGAAAGTTAAGTATGCCGCACAAATATTTAGCCAAACAGTGGCTGCTGTTCTTAAATTATTAGCTACGAATGTGGAAAATGTACACCGATCAGATGAAATATTACAGACTGCTTTGTTAATTGAAAAATTCAATAAACTTTTTGATTATACAAATGGGCCATCAGGACATGCTGACGTAAAAAAAGGTATACGGGAAAACGTATCTGCTAAAACTGACCATTTAGCTGTTTGGACAGAATATAGAAAGCAACTGTCTACTTTAACATTTTTCAACCATAATGGCGTGGAAGCAAAAAATGTAAAGTGTGTTCAAGGCTACATTATATCATTAAAATCGCTGCGTGATATTTGGCTGGAAGTTCAGGATTTAGGATATAAGTATTTGAATCTACGGCAGTTAAACCAGGATGCATTAGAAAATTTATTTGGGTTAATAAGACAGCATGGTCAAACAAACAAGCATCCGACGTGTTCTACATTTATAGCAGCTATGAAAACCTCTATAATATCAGGACTTACCGCCCCTCACAGCAAAAACTCCAATTGTGAAGAAGACAAAAAGGAACTCATGACGGATTTTCATGATTTAGTTTTTGGGTTTAAAGACGAAGATGATCAAGGTCAAGATATTAATGAGTCTCCTAGTCATGTTTCCACAGAAAATGAAAATGAGGAAGACAACCCGGTTCTCAGTATACCTGAAGAAGAAGAATATAAAGAAATAGTATGTGACCTAGCAAAAATTTCAAATCAACCAGTGGTCTATATAAGTGGATATCTAGCTTCTGTTATTCTAAAAAAAAATGATTGCCAGGTCTGTAGAGAAACTTTGACAGTTGCAGATCCAGAGGAAAATAAGATTTATGATTTAATTAAATTAAGGGAGTGGTGGCAAGATAAGAAATGTTTGACATATCCATCATTGCAGTTGTGTCAAACTGTACACACTGCGGTTACAAATTTTGAACAGTTTTGACTGAGCCTCTCAAGTTTGAAGAAGCATAAGGCTTTGATCCCTCTGTATGTATGTGTGGGGATAGGATGTGGTGGAGCTGTGTTCTATACTCTGCGTCTGGCTTTGCGTAATCCTGATGTATCTTGGAACAAGAAGACCAACCCTGAACCATGGGAGGCTTACAGGAACAAGCAGTACAAGTTCTATTCTCCCATCAGAGACTACTCTAAGGAGGAATCTCCTGCCCCCAAATACTAA
Protein
MPDTHRTCEVCGIKERHLTEKRFFARFPLDVNRCKQWVKMVGKEDLAYLQVHMLHDLKHVCEAHFSRRDFTKSKKRLKKRAVPKLNLTLPPLRDEILLQFLQLNSQADVTPQGQFEVQAVPSALMPASSSQPSGLEKTDVTPQGQFEVQAVPCTSMPTSSSQSSSLEKNVTKGSQRKESESQIRKRKLEDVDVTPRKRKLLSELRKTKCTLASLKKSAKLIDNLSSEFLKEIVTSALINQKRKSQGKRWTIKNKISALAIFKRSPKAYRYLRYLAPFPSIKTLQKLMKKIPVEPGLNTAVLDHLKKLAPIKKIRAKLCSLVFDEIALKERLTYSEATDKVEGFIDYGYERKDELANHALVFMLQGIGRKIKQPLAFYFIRGTVSSEKLAVLIKDIIKEITNSGFQVLSTICDQAPTNMGALSLLKEWNNGGHNYFEFENKKIYIIYDIPHLLKSLRNNFLKQGFLKMGELKGQWSHLVEVEERNRNFLYLSKLKSTHVQPKYRAKMKVKYAAQIFSQTVAAVLKLLATNVENVHRSDEILQTALLIEKFNKLFDYTNGPSGHADVKKGIRENVSAKTDHLAVWTEYRKQLSTLTFFNHNGVEAKNVKCVQGYIISLKSLRDIWLEVQDLGYKYLNLRQLNQDALENLFGLIRQHGQTNKHPTCSTFIAAMKTSIISGLTAPHSKNSNCEEDKKELMTDFHDLVFGFKDEDDQGQDINESPSHVSTENENEEDNPVLSIPEEEEYKEIVCDLAKISNQPVVYISGYLASVILKKNDCQVCRETLTVADPEENKIYDLIKLREWWQDKKCLTYPSLQLCQTVHTAVTNFEQFXLSLSSLKKHKALIPLYVCVGIGCGGAVFYTLRLALRNPDVSWNKKTNPEPWEAYRNKQYKFYSPIRDYSKEESPAPKY

Summary

Pfam
PF12017   Tnp_P_element        + More
PF05485   THAP
PF14291   DUF4371
PF03564   DUF1759
PF04727   ELMO_CED12
PF05585   DUF1758
Interpro
IPR006612   THAP_Znf        + More
IPR021896   Transposase_37       
IPR038441   THAP_Znf_sf       
IPR025398   DUF4371       
IPR006816   ELMO_dom       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR021109   Peptidase_aspartic_dom_sf       
IPR008737   Peptidase_asp_put       
IPR005312   DUF1759       
SUPFAM
SSF57756   SSF57756       
Gene 3D
PDB
5Z62     E-value=1.85724e-12,     Score=179

Ontologies

Topology

Length:
909
Number of predicted TMHs:
1
Exp number of AAs in TMHs:
21.90419
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00031
outside
1  -  843
TMhelix
844  -  866
inside
867  -  909
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0.019225
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号