SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16621
Pre Gene Modal
BGIBMGA004551
Annotation
PREDICTED:_epidermal_growth_factor_receptor_kinase_substrate_8-like_isoform_X5_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 4.011
 

Sequence

CDS
ATGAGTAATAAGCAAGTAACTACGGTATCAAGAAAGTCTTCACACGTAACGAATGATTCACAGAGAAACCAGCGCCAAAGATTGAGGCGCTGCTCCACCGCCCCCGCGCCGCCTCCTCCACCCCCGGAGCCGCCGTCACCGCCACCCATCAAATCTGATACTTTGAAATCCACCAAATCGATAATGAGTACTGGCGGCAGTCTCCACGATGAACTGAAGCTAGTACTGCCCCAGATACAGCAAAGAAGAAACAAACTCGACATCAAGAAGACTCCAGATATATTCATTGATCAGAAATCGAATCCGGACGAGGTTGTGGAATGGCTCGAAGCAAAGGGTTTCAGCAATGCCGCCCAACGCCAGCTGAGGATGTCGGACACCAGCTATTCGCGCTGTCCAGATCTCAGCTGGAGAGGGCACTGGGCCAGGATGAGGGGAAACGACTGTACAGCCAAATTTTGGTCCAGAGGAACGTGTCTGGGGTGA
Protein
MSNKQVTTVSRKSSHVTNDSQRNQRQRLRRCSTAPAPPPPPPEPPSPPPIKSDTLKSTKSIMSTGGSLHDELKLVLPQIQQRRNKLDIKKTPDIFIDQKSNPDEVVEWLEAKGFSNAAQRQLRMSDTSYSRCPDLSWRGHWARMRGNDCTAKFWSRGTCLG

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
161
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.38201
outside
1  -  161
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号