SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16616  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA012651
Annotation
PREDICTED:_uncharacterized_protein_LOC106139693_isoform_X1_[Amyelois_transitella]
Location in the cell
Cytoplasmic   Reliability : 1.098 Mitochondrial   Reliability : 1.308
 

Sequence

CDS
ATGAAAAGATCTGCAATACAATTCTTGATTGACGAATACGGGAAGTTTCCAGTTGAGAATTCTATCTTGGCTACAAAGTTAGAGGAAGCCGGCATAGCAGAGAGCGTTGAAATACTCAATGAAATTATAAATAGGTACTGTGATATGAGCGATTCTGACGAGGGCTCCAGTGACAGAGAATCGGCGGGATCCAAGAAGTACCAAGGTCGCACATTTGGTGGACTGCGTGATAAATCAGCTCGCAACTATACAGGCAAAGTTGACAAGGAGGCAACAATTCTATGTATCAATCTACAAGGACATCGGCCGGTCCTAGCAGGAGGAGCAGTTGGATGCCTCGCAGGACCGGCAGGAGCTGCATTGGGAGGCGTATACGGAGGCATGATTACAGACGGCTTGGTTTCTGCGGCTAAGAACGAGCCTGTAGGTATTTTTGAGTCAAGTGCAAATATAGGTAGAGACATTGCTTCAGGCAAAAATCCAATGGCTTCTGTGGGTTCCGTAAGTTTCAAAATCGCCATGGACGGTATAGGTGGCTTTGGCATGGGAGGAGTTTCTAGCGTTGCCAGTAAAGTCCCGGCGAAGGCCGTCGCAAAAACCATAGAAGGCACTGTAAAAAAAGCTGCTGCAACTATTGGGGAGGAGATGATTGAGAAGTCAGTGCAATTAACTGCAGAAGAAATGACAAAAATTGTGGCAAAGAAAGTGTCAGAAAAAGCCGTGAAAAAAGCTGTCGAAACTGCAGCAATACAAACACAAATGCTTCTGGTGTCTGCTCACGTCGGAGTAAATGCTAGTGAAAAAACCAAAGCTGAAATGCGTGCTGAAGAAGAACGTAAACAACAGAAACAAAAAGAAGAAGAAAAAAAGGCGCGTGAAAATCGCGATAAAAAAAATACTGGATCGTGGCAACCGCCACGCGAGAACAGAAACAATAAAGAGTCCAATGTTGATAATGAAGAGTCCGACGAGGAGGTATTTGAAAAGTTCATGAAATTACTTAAACAGCTCTTGAAGCTTCTCTACGGCAATAACAGCGAACCGTTCACAAGAATTTTCGAGAATTTATCACCAGGCCAAATAGCGTATTTGGTGAAAATAATCAGAAACCTTAACTCAACTGGAATTTTACAGATAGTGTTAGATTTTACATTAAAACTGTTTAAATTGTACTTTTCTAAAGATATCTCATTCACAAATATCCTGAGTATGTTAGAATTCGTCGCAACTTACATTGAAGACCAGTTGTATTTTATGACCAAAACCAAAGAAAATTGCTGA
Protein
MKRSAIQFLIDEYGKFPVENSILATKLEEAGIAESVEILNEIINRYCDMSDSDEGSSDRESAGSKKYQGRTFGGLRDKSARNYTGKVDKEATILCINLQGHRPVLAGGAVGCLAGPAGAALGGVYGGMITDGLVSAAKNEPVGIFESSANIGRDIASGKNPMASVGSVSFKIAMDGIGGFGMGGVSSVASKVPAKAVAKTIEGTVKKAAATIGEEMIEKSVQLTAEEMTKIVAKKVSEKAVKKAVETAAIQTQMLLVSAHVGVNASEKTKAEMRAEEERKQQKQKEEEKKARENRDKKNTGSWQPPRENRNNKESNVDNEESDEEVFEKFMKLLKQLLKLLYGNNSEPFTRIFENLSPGQIAYLVKIIRNLNSTGILQIVLDFTLKLFKLYFSKDISFTNILSMLEFVATYIEDQLYFMTKTKENC

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
426
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
6.95564999999999
Exp number, first 60 AAs:
0
Total prob of N-in:
0.24084
outside
1  -  426
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
31250652 AKIIITFQRYYVNDSFYDFKNQGPVFLMIGGEGPADARWMVTGTWINYAKKFNALCINLEHRFYGESHPTL 100.00 9e-119
28556443 SAIQFLIDEYGK 100.00 2e-09
26280517 NDPVVITDFHDGPGWK 100.00 8e-04
28556443 IAMDGIGGFGMGGVSSVASK 100.00 8e-04
28556443 IAMDGIGGFGMGGVSSVASK 100.00 8e-04
28556443 LDTSVLMK 100.00 0.009
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号