SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16605  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA012651
Annotation
PREDICTED:_uncharacterized_protein_LOC106139693_isoform_X1_[Amyelois_transitella]
Location in the cell
Cytoplasmic   Reliability : 1.687 Mitochondrial   Reliability : 1.127
 

Sequence

CDS
ATGTCTTTGAAGAATAGGTTAATTGCATGTCTACAAAAACTAAAGGAATACGATTACACTGACGTAGACAAGGCAAGAGCTAGTGACGCGAAGGCCGAGAATGCCCTCAACTTAATATACCAGACCGCTTTAAAGAAAACAACTTTTACAACAGAAGAGAAGAAAATTGTAGGTTCTCTTTTATTTGATGCCATCACACCGATACAAAGCAACATAGAAGGAACGCTCTGCGAATACAGAACTAGATTAGATACCTCTGTGCTTATGAAAAGATCTGCAATACAATTCTTGATTGACGAATACGGGAAGTTTCCAGTTGAGAATTCTATCTTGGCTACAAAGTTAGAGGAAGCCGGCATAGCAGAGAGCGTTGAAATACTCAATGAAATTATAAATAGGACATCGGCGGTCCTAGCAGGAGGAGCAGTTGGATGCCTCGCAGGACCGGCAGGAGCTGCATTGGGAGGCGTATACGGAGGCATGATTACAGACGGCTTGGTTTCTGCGGCTAAGAACGAGCCTGTAGGTATTTTTGAGTCAAGTGCAAATATAGGTAGAGACATTGCTTCAGGCAAAAATCCAATGGCTTCTGTGGGTTCCGCAAGTTTCAAAATCGCCATGGACGGTATAGGTGGCTTTGGCATGGGAGGAGTTTCTAGCGTTGCCAGTAAAGTCCCGGCGAAGGCCGTCGCAAAAACCATAGAAGGCACTGTAAAAAAAGCTGCTGCAACTATTGGGGAGGAGATGATTGAGAAGTCAGTGCAATTAACTGCAGAAGAAATGACAAAAATTGTGGCAAAGAAAGTGTCAGAAAAAGCCGTGAAAAAAGCTGTAGAAACTGCAGCAATACAAACACAAATGCTTCTGGTATCTGCGCACGTCGGAGTAAATGCTAGTGAAAAAACCAAAGCTGAAATGCGTGCTGAAGAAGAACGTAAACAACAGAAACAAAAAGAAGAAGAAAAAAAGGCGCGTGAAAATGGCGATAAAAAAAATACTGGATCGTGGCAACCACCACGCGAGAACAGAAACAATAAAGAGTCCAATGTTGATAATGAAGAGTCCGACGAGGAGGTATTTGAAAAGTTCATGAAATTACTTAAACAGCTCTTGAAGCTTCTCTACGGCAATAACAGCGAACCGTTCACAAGAATTTTCGAGAATTTATCACCAGGCCAAATAGCGTATTTGGTGAAAATAATCAGAAACCTTAACTCAACTGGAATTTTACAGATAGTGTTAGATTTTACATTAAAACTGTTTAAATTGTACTTTTCTAAAGATATCTCATTCACAAATATCCTGAGTATGTTAGAATTCGTCGCAACTTACATTGAAGACCAGTTGTATTTTATGACCAAAACCAAAGGTAAGCCGACTCGTCAATCAGATGCCGACCGAAATGAGCGTCGAAGGAACGCCATCAAAGAACTTCAAAACAAAAGGGATATAATTCAGAAAATTGCTGATCTATTCAGACATTTACAAGCGGAAATCATAGCTGAAACGAGCGCGCCTAATATAATTTCCCCCTATTTTCGTGATATATTCGCAGCTGTGTATCATTATTACAAACACAGACGCGTGCCCGTGCCAGGCCATGAGAAGCTGACAGTCAAACAATATTTCGACTTGATAAGGATGGTAATTATAAAAATGAAAGAATCACCGGAATACAAAAAAATGCAGAGGGCCAGAAATGGAACGACCCTCACTTGTGAAATGTACGTGGTCTTGTTCGGTAGGATGTTCAGAATTATTATTACTGTTCGAGATGGTGAAATTGTATTGAGTACCGCCTATGTAGTCAAGCGTATGAACTTTAATGCCAAAGAAGGCATTCTTTACATAAAATTCGATGACGGAGATCCGCTGAGTGAGAGTGAAGTGGCCGTCATTGACGTACTGATCGATCGAGGGTCACAGACTGCAGGTACACTCGACTATAACATCGTTAAGAGCCTGTACAGACGGGGTCTGGTGTACGTGGACGTGCCTATAACGGCGGCTGATAAGGTGTCCGTCCCTCCGTTGAAGGGCTTCGTCATGAACCGTGTGGCCGGGGACTACTTCGAGACCTTGCTGTACAAGGTGTTCGTTTCCATCGACGAGCACACCGGGGTCGGGGAACTTGCTGCCGTCCTCCAGGTTGACTGCGAGCTGGTGAAGCAAGCGGTTTCGCTGTACTGCCGGCTCGGGTTCGCGAACAACCTGCACCCCCCGCCCGTCTCCCCGCCGCACCCCTCCTGGAGCGACGCGGTCACGACACACACCCATCCGCCGTGA
Protein
MSLKNRLIACLQKLKEYDYTDVDKARASDAKAENALNLIYQTALKKTTFTTEEKKIVGSLLFDAITPIQSNIEGTLCEYRTRLDTSVLMKRSAIQFLIDEYGKFPVENSILATKLEEAGIAESVEILNEIINRTSAVLAGGAVGCLAGPAGAALGGVYGGMITDGLVSAAKNEPVGIFESSANIGRDIASGKNPMASVGSASFKIAMDGIGGFGMGGVSSVASKVPAKAVAKTIEGTVKKAAATIGEEMIEKSVQLTAEEMTKIVAKKVSEKAVKKAVETAAIQTQMLLVSAHVGVNASEKTKAEMRAEEERKQQKQKEEEKKARENGDKKNTGSWQPPRENRNNKESNVDNEESDEEVFEKFMKLLKQLLKLLYGNNSEPFTRIFENLSPGQIAYLVKIIRNLNSTGILQIVLDFTLKLFKLYFSKDISFTNILSMLEFVATYIEDQLYFMTKTKGKPTRQSDADRNERRRNAIKELQNKRDIIQKIADLFRHLQAEIIAETSAPNIISPYFRDIFAAVYHYYKHRRVPVPGHEKLTVKQYFDLIRMVIIKMKESPEYKKMQRARNGTTLTCEMYVVLFGRMFRIIITVRDGEIVLSTAYVVKRMNFNAKEGILYIKFDDGDPLSESEVAVIDVLIDRGSQTAGTLDYNIVKSLYRRGLVYVDVPITAADKVSVPPLKGFVMNRVAGDYFETLLYKVFVSIDEHTGVGELAAVLQVDCELVKQAVSLYCRLGFANNLHPPPVSPPHPSWSDAVTTHTHPP

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
761
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
11.13491
Exp number, first 60 AAs:
0.00035
Total prob of N-in:
0.47901
outside
1  -  761
 
 

Population Genetic Test Statistics

Pi
10.462024
Theta
16.286796
Tajima's D
-0.902323
CLR
0.16229
CSRT
0.155242237888106
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
31250652 AKIIITFQRYYVNDSFYDFKNQGPVFLMIGGEGPADARWMVTGTWINYAKKFNALCINLEHRFYGESHPTL 99.14 0.0
28556443 SAIQFLIDEYGK 100.00 3e-09
28556443 EYDYTDVDK 100.00 9e-05
26280517 NDPVVITDFHDGPGWK 100.00 6e-04
28556443 IAMDGIGGFGMGGVSSVASK 100.00 6e-04
28556443 IAMDGIGGFGMGGVSSVASK 100.00 6e-04
28556443 LDTSVLMK 100.00 0.014
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号