SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16578  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA005570
Annotation
PREDICTED:_lethal(2)_giant_larvae_protein_isoform_X2_[Bombyx_mori]
Location in the cell
PlasmaMembrane   Reliability : 1.23
 

Sequence

CDS
ATGCAGAACTGCCCAGAGGATTACAAAGTTAACCCAGGCGCGGTGGAGTCTGTATACGAACACCCTAAGACTCCTACACGTATTCTGATCGGATACAACCGAGGACTGGCCGTGCTTTGGGACCGGGAGGCTGCGGCTCCCACACATACATTTGTTTCGAATCAACAGCTTGAAAGCTTATGCTGGAATGACGATGGCGAGCACTTCACATCATCGCACAACGACGGTTCGTACGTGACGTGGGAGGTGGCCGGCGCCTCCAGCGACCGACCCCTGAAGGAGCCCGTCACGCCCTACGGACCCTACCCTTGTAAGGCGATCACCAAGATCCTGAACAGGACTAGCGTTGATGGAGAGGACATCACTATATTTGCCGGTGGCATGCCCAGAGCTTCGTACTCCGACAAGTACACGGTTACCGTGCAGCAGGGCGAGAAACATGTGGCCTTCGATTTCACGAGCCGGGTGATAGATTTGTTCACAACGACTCCCGTGCCCCCGGACGGCGCGCCGCTGCAGGAGGAGCAGCCCGACACCCCGGCCCTCGTACAGGTGCAAGCGGTCAACCAGGTCGCCGCCGCTTTGGTGGTCCTGGCGGAAGAGGAGCTGGTGGTGATAGACCTATGCGACGCGCGCTGGCGGCCGCTGCGGCTGCCGTACCTGGTGTCGGTGCACGCGTCCGCCGTCACCACGGCGCAGCTGGCCGACGGCGTGGCGCCCGCAGTCTACGACAACATCGTCGCCGCGGGTCAACAACAAACGGAGAATCAATACTCGGAGAGTCCGTGGCCGATATCCGGTGGAGTGGTGGAGACGGCGGAGCTGACCGACAGACAGGTGCTGCTCACGGGGCACGAGGACGGCTCCGTGCGGTTCTGGGACGTGACCGGCGTCGCCATGACCCCCCTGTACAAGTACACCACCGCGCAGCTGTTCAGTGGTGAAGAACTTGGTGAAAACAACGACAGTCAGACCACAGATGAAGAGGAGTGGCCTCCCTTCAGGCGAGTCGGCACCTTCGACCCGTACAGCGACGACCCCCGGCTCGCGGTCAAAAAGGTTATATTGTGCCCGTTATCTGGAATGCTCACCATCGGCGGAGCCGCCGGCCATATTGTCATAGCCAGTCTCAAGACCTCTCCGAGCACCACCGAAGTCAAGTCGGTGTCAGTGAATATAGTGTCAGACAGAGACGGCTTCGTGTGGAAGGGACACGGGCAGCTCACGTTGAGGGCCGGCACGCACACCTTCCCGCAGGGATATCAGGCGACCTCGGTGGTGCAGCTGCAGCCCCCGGCGGCCGTGACGTCACTGAGCGCGCAGTGGGAGTGGGGCGTGGTGTGCGCCGGCACCGCGCACGGGCTGGCGCTGGTGGACGCGCTGGGCCCGGCGCCCGCGCCGCTGCTGCATAAGTGCACGCTCAACCCGCACGATCACGGATCCGGTGACACGCCAATATCGAGAAGAAAGTCCTTCAAGAAATCCTTGAGAGAGTCATTCAGGAGGCTTCGTAAAGGACGTTCACAACGGCGACAGACGACATCGAATCCCACCTCGCCCACACAACCGATTCCGAAGAAGCCAATTGACAAAGCCGCCTCGGAAACGGACGCGGAAATCAAACCGATCGAGCGCGCGGTGGAGGCCCGCTCCACGGACGACGCCTACGGCTCGATGGTGCGCTGCCTGTACTTCGCGAGGACCTTCCTCATCAATACCCAGCAATCGACGCCGACGCTATGGGCCGGCACGAACAACGGCACTGTGTACGCCTTCACGCTGCACGTGCCCAACACTAACAAACGGAAAGAGGAACCAGTAACGTGTCAGCTAGCGAAAGAAATACAGTTGAAGCACAGGGCCCCGGTCATAGGGATCACAGTACTCGACGGCGCCTCCGTACCTCTGCCCGATCCCCTAGAGGTGGAACGAGGTGTGTCCCCGCTACCGGAGCCGGGTACACATCGTGTGGTCATCACGTCGGAGGAACAGTTCAAGATATTCACTCTGCCTTCGTTGAAACCGCACAACAAGTACAAGCTGACCGCGCACGAGGGCGCTCGGGTTCGGCGCACGGCGTGGTCGCAGTTCTCGTGCGGCGCGCACCGGGAGTGGTGCTTGCTGTGCCTCACCAACCTCGGCGACTGCCTCGTGCTCAGCCCGGAGCTGCGCCGCCAGCTCAACGCCGCCGCCGTCAGGAAGGAGGACATCAATGGGATTTCGAGTTTATGTTTCTCGAAGCGAGGAGAAGCTCTCTACCTGCACTCGTCTTCCGAATTACAACGGATTACTTTATCTGCTACGAAGGTGACGATCGCGGAGTGCCACGTGCTGCTGGCGCCCTGGGCGGCCGCGCTGCGGGGACCCGCGCCGGAGCCGCCGCTCACCAACGGGGAGCATAAGGTAGACTGTGTACTCATAGTGGGATTGACGATACAGGAAGAGGTGCCGGAGACAGCTCATGACGTCACGGCGGCCTCGGCGGACATCACCGTGGACAGCGTGCGCGACCACACCAGCGCGGAGCACCCGCCCGAACTCAACATCAACTTACAAAACACGCAAGTGAATACGAGTTCGATGGTAATAAAGACAACGACACGCACGACCGTGAACGAGACCAACGCGGACGGCACCACCACCACCACCACGACCAGCACTAACAACGCCAACGAGAACAATTTGTGTTTGTTTGACGGGCGCTTTATGTTTTTGTTCGTAGTCCTAGAGCACAGTCGCGAGGAGGGAGTCATCACCCGCATCGAGACGGGAACCGTGACGGTGCCGGCCGGCACAGATCCGAAGCTGATCCTCGAGATGTTTGATCGACAACGGTCCCCCCTGGCGGTCCCCGTGCCGCCCCCCACTGACGCGCACTGA
Protein
MQNCPEDYKVNPGAVESVYEHPKTPTRILIGYNRGLAVLWDREAAAPTHTFVSNQQLESLCWNDDGEHFTSSHNDGSYVTWEVAGASSDRPLKEPVTPYGPYPCKAITKILNRTSVDGEDITIFAGGMPRASYSDKYTVTVQQGEKHVAFDFTSRVIDLFTTTPVPPDGAPLQEEQPDTPALVQVQAVNQVAAALVVLAEEELVVIDLCDARWRPLRLPYLVSVHASAVTTAQLADGVAPAVYDNIVAAGQQQTENQYSESPWPISGGVVETAELTDRQVLLTGHEDGSVRFWDVTGVAMTPLYKYTTAQLFSGEELGENNDSQTTDEEEWPPFRRVGTFDPYSDDPRLAVKKVILCPLSGMLTIGGAAGHIVIASLKTSPSTTEVKSVSVNIVSDRDGFVWKGHGQLTLRAGTHTFPQGYQATSVVQLQPPAAVTSLSAQWEWGVVCAGTAHGLALVDALGPAPAPLLHKCTLNPHDHGSGDTPISRRKSFKKSLRESFRRLRKGRSQRRQTTSNPTSPTQPIPKKPIDKAASETDAEIKPIERAVEARSTDDAYGSMVRCLYFARTFLINTQQSTPTLWAGTNNGTVYAFTLHVPNTNKRKEEPVTCQLAKEIQLKHRAPVIGITVLDGASVPLPDPLEVERGVSPLPEPGTHRVVITSEEQFKIFTLPSLKPHNKYKLTAHEGARVRRTAWSQFSCGAHREWCLLCLTNLGDCLVLSPELRRQLNAAAVRKEDINGISSLCFSKRGEALYLHSSSELQRITLSATKVTIAECHVLLAPWAAALRGPAPEPPLTNGEHKVDCVLIVGLTIQEEVPETAHDVTAASADITVDSVRDHTSAEHPPELNINLQNTQVNTSSMVIKTTTRTTVNETNADGTTTTTTTSTNNANENNLCLFDGRFMFLFVVLEHSREEGVITRIETGTVTVPAGTDPKLILEMFDRQRSPLAVPVPPPTDAH

Summary

EMBL
ODYU01004452    SOQ44334.1    KQ459232    KPJ02644.1    AGBW02013517    OWR43276.1    + More
FP102341    CBH09297.1    KQ461155    KPJ08288.1    GEZM01042811    JAV79576.1    GEZM01042812    GEZM01042810    JAV79577.1    KZ288255    PBC30662.1    KJ434293    KQ971356    AHY24027.1    EFA09125.1    KYB26183.1    KK107148    EZA57460.1    NEVH01019065    PNF23209.1    GL442047    EFN64009.1    KQ414806    KOC60618.1    PNF23211.1    QOIP01000009    RLU18875.1    KQ977279    KYN04048.1    LJIG01001374    KRT85566.1    KQ434846    KZC08328.1    GL888181    EGI65779.1    KQ982673    KYQ52436.1    GBYB01010942    JAG80709.1    KQ976435    KYM87099.1    ADTU01026117    GBYB01009562    JAG79329.1    GBYB01010947    JAG80714.1    APGK01039896    KB740975    ENN76455.1    GBYB01009564    JAG79331.1    GEDC01019629    JAS17669.1    KB632186    ERL89741.1    KQ978878    KYN27856.1    GEDC01023891    GEDC01022956    GEDC01002554    JAS13407.1    JAS14342.1    JAS34744.1    KQ981382    KYN42351.1    GEDC01021619    JAS15679.1    KQ435724    KOX78389.1    GL445887    EFN88894.1    NNAY01000642    OXU27238.1    KQ435881    KOX69842.1    GDKW01001880    JAI54715.1    GBBI01003141    JAC15571.1    GBGD01000260    JAC88629.1    ACPB03000213    GFTR01008501    JAW07925.1    GECL01003493    JAP02631.1    GBHO01038923    GBHO01038922    GBHO01021108    GBHO01021059    GBHO01017046    GBHO01011663    GBHO01011660    GBHO01011657    GBHO01011656    GBHO01011655    GBHO01006591    GBHO01006590    GBRD01014279    GBRD01014278    GDHC01018735    JAG04681.1    JAG04682.1    JAG22496.1    JAG22545.1    JAG26558.1    JAG31941.1    JAG31944.1    JAG31947.1    JAG31948.1    JAG31949.1    JAG37013.1    JAG37014.1    JAG51547.1    JAP99893.1    GBHO01023873    GBHO01018251    GBHO01018222    GBHO01017047    GBHO01017045    GBHO01017044    GBHO01017042    GBHO01011661    GBHO01011659    GBHO01011654    GBHO01006592    GBHO01001777    GBRD01017551    GBRD01010369    GDHC01010587    JAG19731.1    JAG25353.1    JAG25382.1    JAG26557.1    JAG26559.1    JAG26560.1    JAG26562.1    JAG31943.1    JAG31945.1    JAG31950.1    JAG37012.1    JAG41827.1    JAG48276.1    JAQ08042.1    GFAH01000325    JAV48064.1    KK116537    KFM68057.1    GEDC01016600    JAS20698.1    GGMS01015013    MBY84216.1    GFXV01007405    MBW19210.1    GGMR01014093    MBY26712.1    ABLF02035340    DS235440    EEB15731.1    KK854212    PTY13166.1    QCYY01002835    ROT67186.1    KB200521    ESP01458.1    GG666591    EEN51430.1    GL732577    EFX75147.1    NEDP02004422    OWF45664.1    GFDF01003478    JAV10606.1    GFDF01003477    JAV10607.1    AHAT01013466    AHAT01013467    AHAT01013468    AHAT01013469    GFDF01003476    JAV10608.1    JH818286    EKC19885.1    AAEX03003715    BX649356    BX649547    KB528467    EMP35543.1    AEMK02000083    MKHE01000005    OWK15241.1   
Pfam
PF08366   LLGL        + More
PF00096   zf-C2H2
PF00400   WD40
PF08596   Lgl_C
PF12894   ANAPC4_WD40
PF09457   RBD-FIP
Interpro
IPR036322   WD40_repeat_dom_sf        + More
IPR013087   Znf_C2H2_type       
IPR019775   WD40_repeat_CS       
IPR036236   Znf_C2H2_sf       
IPR001680   WD40_repeat       
IPR017986   WD40_repeat_dom       
IPR012934   Znf_AD       
IPR013577   LLGL2       
IPR015943   WD40/YVTN_repeat-like_dom_sf       
IPR000664   Lethal2_giant       
IPR013905   Lgl_C_dom       
IPR024977   Apc4_WD40_dom       
IPR019018   Rab-bd_FIP-RBD       
IPR037245   FIP-RBD_C_sf       
SUPFAM
SSF50978   SSF50978        + More
SSF57667   SSF57667       
SSF144270   SSF144270       
Gene 3D
PDB
6N8S     E-value=8.61845e-166,     Score=1502

Ontologies

Topology

Length:
959
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.45135
Exp number, first 60 AAs:
0.0001
Total prob of N-in:
0.02028
outside
1  -  959
 
 

Population Genetic Test Statistics

Pi
21.027004
Theta
24.009066
Tajima's D
-1.023903
CLR
0.064906
CSRT
0.131893405329734
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
31250652 ITYLFVIVWSYGVCCLLVRAENKPESAVAVHCVAGLGRAPVMVAIALIELGMKYEEAVETIRE 97.96 5e-26
28556443 ASALAWDPLLR 100.00 9e-12
26822097 HVAFDFTSR 100.00 3e-05
28467696 TSVAAEKPININIK 100.00 3e-05
28556443 LQNELFAFR 100.00 3e-05
28556443 STDDAYGSMVR 100.00 3e-05
28556443 VVITSEEQFK 100.00 6e-05
28556443 ASALAWDPLLR 100.00 6e-04
28556443 DHTSAEHPPELNINLQNTQVNTSSMVIK 100.00 6e-04
26822097 ITISATK 100.00 0.007
28467696 TAVPEFFTNR 100.00 0.007
26822097 ASAIAWDPIIR 100.00 0.007
28467696 IETGIAQVFIK 100.00 0.007
28556443 FWDVTGVAMTPLYK 100.00 0.007
26822097 VGTFDPYSDDPR 100.00 0.014
28467696 VNNYPTPNTCYTVSDIR 100.00 0.014
28556443 VGTFDPYSDDPR 100.00 0.014
28556443 VGTFDPYSDDPR 100.00 0.014
28556443 ISAICVESSAK 100.00 0.032
28556443 SVSVNIVSDR 100.00 0.043
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号