SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16563
Pre Gene Modal
BGIBMGA012072
Annotation
PREDICTED:_mucolipin-3-like_isoform_X1_[Amyelois_transitella]
Location in the cell
Nuclear   Reliability : 1.415 PlasmaMembrane   Reliability : 1.597
 

Sequence

CDS
ATGGATGAAATCATGCATGCCCCTGATGATACTACCTGTTCTGAAGGCGAAGACGATCACAAAAAGGAAATTCGACCGAATGCCAACAATGAACAAGATTTTCCTCACCAATCGACTTCGTTCTCTCCGCCTACTCAAATGGAAGAAAAAATGCGTAGAAAACTGCAGTTTTTCTTTATGAATCCAATCGAGAAATGGAAAGCAAAGAGAAAATTTCCTTACAAATTTGTCGTGCAGGTAATCAAAATTGTACTTGTGACTTTTCAACTATGTTTATTCGCTCATAACAGATACAATCACGTGAACTATACATGGGATAACAGAATCACATTCTCGCATCTATTTTTACTCGGCTGGGACTCTACACGTGAGATAAACGCATATCCACCGGGAGCAGGACCACTTGCTTTGTACAAAATCGATGAGTTCTACAATACATTAGACTATGCAGTTGCCGGTTATACTAATTTATCTAATGCGATAGGCCCATATTCGTACAATGATGAAAATAACTTTATGCCAGATCCTGTCTTTTGCCAGTACAACTATAAACAAGGCATTATTTATGGCTTTAATGAGAGCTACCAGTTTAACTCTGAAGTCTTTGAGACCTGTATAAATTTCACAATTAAAGATAATGAAGATTTCAAATCTGAAGCGTACATTAGAGATGCTGGATTGAACATCAGTTTCTCATCATTAGTTAGAGCAAAATTAATGTTTTCCATCAAAACCATCAACTTCAGGGCTGCCGGTCCCATAACTCCACCAGACTGTTACCGGTTGATGTTGAAATAA
Protein
MDEIMHAPDDTTCSEGEDDHKKEIRPNANNEQDFPHQSTSFSPPTQMEEKMRRKLQFFFMNPIEKWKAKRKFPYKFVVQVIKIVLVTFQLCLFAHNRYNHVNYTWDNRITFSHLFLLGWDSTREINAYPPGAGPLALYKIDEFYNTLDYAVAGYTNLSNAIGPYSYNDENNFMPDPVFCQYNYKQGIIYGFNESYQFNSEVFETCINFTIKDNEDFKSEAYIRDAGLNISFSSLVRAKLMFSIKTINFRAAGPITPPDCYRLMLK

Summary

Similarity
Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Kinesin family.
Belongs to the ligand-gated ion channel (TC 1.A.9) family.
EMBL
BABH01016087    GDQN01004566    JAT86488.1    ODYU01010693    SOQ55970.1    NWSH01000052    + More
PCG80175.1    JTDY01004240    KOB68403.1    KQ461185    KPJ07466.1    KQ459252    KPJ02154.1    GAIX01000494    JAA92066.1    AP017502    BBB06793.1    AGBW02013309    OWR43618.1    KK852750    KDR17190.1    PYGN01001379    PSN35272.1    NEVH01007419    PNF35727.1    PNF35724.1    PNF35721.1    PNF35726.1    KQ976885    KYN07463.1    KQ971361    EFA09175.1    KQ759841    OAD62624.1    GEZM01064807    JAV68638.1    GEBQ01014019    JAT25958.1    AJWK01000543    GL888412    EGI61375.1    GEBQ01021505    JAT18472.1    GAMD01000744    JAB00847.1    KZ288185    PBC34954.1    ADTU01017350    ADTU01017351    GEBQ01007289    JAT32688.1    KQ976453    KYM85515.1    GFDF01009557    JAV04527.1    AXCN02000895    GGFK01005388    MBW38709.1    GGFK01005491    MBW38812.1    KQ414782    KOC61158.1    GGFJ01003085    MBW52226.1    ADMH02001258    ETN63365.1    AAAB01008807    EDO64504.1    GL434905    EFN74349.1    GGFM01002467    MBW23218.1    GGFM01006975    MBW27726.1    KQ978889    KYN27662.1    KK107163    QOIP01000002    EZA56523.1    RLU25816.1    LBMM01003811    KMQ93109.1    GBBI01002583    JAC16129.1    GEDC01008117    JAS29181.1    GEDC01010424    JAS26874.1    GL448268    EFN84982.1    GEDC01030678    GEDC01026620    GEDC01005880    GEDC01002170    JAS06620.1    JAS10678.1    JAS31418.1    JAS35128.1    KQ982454    KYQ56180.1    KQ434777    KZC04152.1    AXCM01000589    KX249700    AOR81477.1    GAMC01016048    JAB90507.1    GECU01034559    JAS73147.1    GECZ01010205    JAS59564.1    ACPB03011941    GEDC01030005    JAS07293.1    GAKP01015399    GAKP01015397    JAC43553.1    GDHF01032990    GDHF01027057    JAI19324.1    JAI25257.1    GBXI01010418    JAD03874.1    GGMR01009352    MBY21971.1    JXUM01015881    KQ560442    KXJ82386.1    GBYB01006334    GBYB01013234    JAG76101.1    JAG83001.1    JXUM01049861    KQ561624    KXJ77966.1    GL763562    EFZ19447.1    DS232132    EDS35780.1    ABLF02022564    HF586479    CCQ71383.1    CH477221    EAT47288.1    GFDL01009472    JAV25573.1    GFDL01010031    JAV25014.1    GGMS01001274    MBY70477.1    GFDL01010000    JAV25045.1    KA646156    AFP60785.1    GFXV01003061    MBW14866.1    UFQS01001196    UFQT01001196    SSX09641.1    SSX29437.1    JXJN01026843    CCAG010012768    NNAY01003212    OXU19782.1    CP012525    ALC44442.1    JRES01000760    KNC28588.1   
Pfam
PF08016   PKD_channel        + More
PF13426   PAS_9
PF16540   MKLP1_Arf_bdg
PF00160   Pro_isomerase
PF00225   Kinesin
PF00520   Ion_trans
PF02932   Neur_chan_memb
PF02931   Neur_chan_LBD
PF00027   cNMP_binding
Interpro
IPR013122   PKD1_2_channel        + More
IPR039031   Mucolipin       
IPR035965   PAS-like_dom_sf       
IPR000014   PAS       
IPR027359   Volt_channel_dom_sf       
IPR006029   Neurotrans-gated_channel_TM       
IPR029000   Cyclophilin-like_dom_sf       
IPR030172   KCNH6       
IPR020892   Cyclophilin-type_PPIase_CS       
IPR000595   cNMP-bd_dom       
IPR006202   Neur_chan_lig-bd       
IPR038105   Kif23_Arf-bd_sf       
IPR002130   Cyclophilin-type_PPIase_dom       
IPR036734   Neur_chan_lig-bd_sf       
IPR032384   Kif23_Arf-bd       
IPR005821   Ion_trans_dom       
IPR036719   Neuro-gated_channel_TM_sf       
IPR027417   P-loop_NTPase       
IPR014710   RmlC-like_jellyroll       
IPR019821   Kinesin_motor_CS       
IPR018490   cNMP-bd-like       
IPR018000   Neurotransmitter_ion_chnl_CS       
IPR036961   Kinesin_motor_dom_sf       
IPR001752   Kinesin_motor_dom       
IPR003967   K_chnl_volt-dep_ERG       
IPR003938   K_chnl_volt-dep_EAG/ELK/ERG       
SUPFAM
SSF55785   SSF55785        + More
SSF52540   SSF52540       
SSF50891   SSF50891       
SSF51206   SSF51206       
SSF63712   SSF63712       
SSF90112   SSF90112       
PDB
6AYG     E-value=2.53769e-29,     Score=319

Ontologies

Topology

Length:
265
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
11.11768
Exp number, first 60 AAs:
0
Total prob of N-in:
0.12189
outside
1  -  265
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号