SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16556  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA010203
Annotation
serine_protease_[Bombyx_mandarina]
Location in the cell
Extracellular   Reliability : 2.611
 

Sequence

CDS
ATGCGCACGCAGCGAAAGCTCTCAAAATGGAAAAAAATTCCGATTTTTCCAGCTGCTTCGGGAGCCAACAACCAACAAAAACGCCAAGTGAGCCTCCAGGTCATTACCAACGCCGTCTGCGCCCGCACGTACGGAAACTCTGTGATCATTGGCTCCACCCTCTGTGTTTCCGGCGCTAACGGTCGCAGCACCTGCAGCGGAGACTCCGGCGGCCCTCTCTCCATCGGCAGCGGCGGAGGCCGTCAGCTGGTCAGTACACTAGTTTTGTTTAACTTTACTGCTTTAACCGGTTGCCTTTTTTTTATTGCTTAG
Protein
MRTQRKLSKWKKIPIFPAASGANNQQKRQVSLQVITNAVCARTYGNSVIIGSTLCVSGANGRSTCSGDSGGPLSIGSGGGRQLVSTLVLFNFTALTGCLFFIA

Summary

Similarity
Belongs to the peptidase S1 family.
Pfam
PF00089   Trypsin
Interpro
IPR033116   TRYPSIN_SER        + More
IPR001254   Trypsin_dom       
IPR009003   Peptidase_S1_PA       
IPR018114   TRYPSIN_HIS       
IPR001314   Peptidase_S1A       
SUPFAM
SSF50494   SSF50494       

Ontologies

Topology

Length:
103
Number of predicted TMHs:
1
Exp number of AAs in TMHs:
26.19571
Exp number, first 60 AAs:
8.44741
Total prob of N-in:
0.77395
inside
1  -  82
TMhelix
83  -  102
outside
103  -  103
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QLIGITSFGSAQGCQR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QLIGITSFGSDR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QVSLQVITNAVCAR 100.00 0.005
28556443 QLIGITSFGSAQGCQR 100.00 0.005
28556443 QLIGITSFGSAQGCQR 100.00 0.005
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号