SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16548  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA010203
Annotation
serine_protease_[Bombyx_mandarina]
Location in the cell
Extracellular   Reliability : 2.115
 

Sequence

CDS
ATGGAAAGGCTGGGTGGCGGGCTGGCGGCTCTCGAAGCGAAACGTATTGTCGCTGGTGACGCTGAACGGCCTGCGTCTACACATGCCGCGGTGTCGGGTGCTGCAGTGACCCGCTCCACCCCCGTACAGGCTCCAGCTACTAGGGCGGGCCCGGGGCGAGACAGAGCCAAGCGGGGGGGCGGCGCTAACGCGAAGTGCACATCGCAAGCGCCTCAACCCCCTGCTTCGGGAGCCAACAACCAACAAAAACGCCAAGTGAGCCTCCAGGTCATTACCAACGCCGTCTGCGCCCGCACGTACGGAAACTCTGTGATCATTGGCTCCACCCTCTGTGTTTCCGGCTCTAACGGTCGCAGCACCTGCAGCGGAGACTCCGGCGGCCCTCTCTCCATCGGCAGCGGCGGAGGCCGTCAGCTGGTCAGTACACTAGTTTTGTTTAACTTTACTGCTTTAACCGGTTGCCTTTTTTTTATTGCTTAG
Protein
MERLGGGLAALEAKRIVAGDAERPASTHAAVSGAAVTRSTPVQAPATRAGPGRDRAKRGGGANAKCTSQAPQPPASGANNQQKRQVSLQVITNAVCARTYGNSVIIGSTLCVSGSNGRSTCSGDSGGPLSIGSGGGRQLVSTLVLFNFTALTGCLFFIA

Summary

Uniprot
ProteinModelPortal

Ontologies

Topology

Length:
159
Number of predicted TMHs:
1
Exp number of AAs in TMHs:
15.08667
Exp number, first 60 AAs:
0.0002
Total prob of N-in:
0.04275
outside
1  -  138
TMhelix
139  -  158
inside
159  -  159
 
 

Population Genetic Test Statistics

Pi
0
Theta
0
Tajima's D
0
CLR
0
CSRT
0
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QLIGITSFGSAQGCQR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QLIGITSFGSDR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QVSLQVITNAVCAR 100.00 0.007
28556443 QLIGITSFGSAQGCQR 100.00 0.007
28556443 QLIGITSFGSAQGCQR 100.00 0.007
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号