SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16533
Pre Gene Modal
BGIBMGA005562
Annotation
hypothetical_protein_KGM_04574_[Danaus_plexippus]
Location in the cell
PlasmaMembrane   Reliability : 4.895
 

Sequence

CDS
ATGGCGGTGTTCGTGTTCTGGTGCTACGCGTGCAAGTTCGTGCCGGCCGCCGTCTCCATCCTCGTGCTGTACGGGCTGACGCTGCGCAGCTTCTGCGAGCAGATCGCGGCCGCCACCAACGCGACGTCGTGCTGGATCGTGTACCCGGTGAACGTGGGCGCGTTCCCGCCCAGCCACGACCTCACCGCGAGGAGCTGGCACGGCTGGGGCGACGACTTCTACGACGGATTCTATTTGACCCAACATATCGTGCTCGCTTTGATAACTTTGCATTTAATTGTGATCTCATTATCATTCGTCCATCGCTACTCGTCGATATGGCAACGTGGCTTCTGGACCAATCGGGCGTGGACCATCACTGTTGTCGTTCTGCTAACCGCTCCGCACTCCCGCAGACTGGTAGTCCAGTGCGCGTTCAGCGGCGTGATGCTGAGCGGCACGTACGGGTCGTGCGCGCGCTGGTCGGTGTGCGCGCTGCGGTACCGCGTGCCGTGGCCGCTGCTGCTCGCGTACGCCGCCTCGCTGCTGCTCGTGCTCGCGCTCAACGAGCTCATCAAGTGGCAGGAGATCAAGGCAGACAAACGGAATCAACGCCGCGCCCGTCTCGACTTCGGAACCAAACTGGGAATGAATTCTCCATTCTAA
Protein
MAVFVFWCYACKFVPAAVSILVLYGLTLRSFCEQIAAATNATSCWIVYPVNVGAFPPSHDLTARSWHGWGDDFYDGFYLTQHIVLALITLHLIVISLSFVHRYSSIWQRGFWTNRAWTITVVVLLTAPHSRRLVVQCAFSGVMLSGTYGSCARWSVCALRYRVPWPLLLAYAASLLLVLALNELIKWQEIKADKRNQRRARLDFGTKLGMNSPF

Summary

EMBL
NWSH01001832    PCG69963.1    RSAL01000090    RVE48102.1    KQ459232    KPJ02629.1    + More
KQ461155    KPJ08304.1    AGBW02013517    OWR43291.1    NEVH01020858    PNF21040.1    PNF21041.1    PNF21037.1    KK853134    KDR10862.1    PNF21038.1    GEDC01023274    GEDC01010258    JAS14024.1    JAS27040.1    GEDC01031434    GEDC01026722    JAS05864.1    JAS10576.1    GEDC01000814    JAS36484.1    GFTR01008638    JAW07788.1    GBBI01003783    JAC14929.1    GEDC01030912    GEDC01010908    JAS06386.1    JAS26390.1    GEDC01026348    JAS10950.1    GEDC01029363    GEDC01008363    JAS07935.1    JAS28935.1    GEDC01020970    GEDC01012123    JAS16328.1    JAS25175.1    KQ759847    OAD62585.1    KZ288308    PBC28715.1    KK854009    PTY09219.1    NNAY01002685    OXU20778.1    KQ435834    KOX71551.1    ACPB03015962    ACPB03015963    GBYB01009580    JAG79347.1    KQ414784    KOC61013.1    LBMM01012452    KMQ86214.1    GL445515    EFN89491.1    GBYB01001767    JAG71534.1    GBYB01001768    JAG71535.1    KQ981561    KYN39827.1    KQ977171    KYN05181.1    GL434335    EFN74998.1    KQ982109    KYQ60000.1    KK107238    EZA54621.1    QOIP01000007    RLU20670.1    GL888167    EGI66276.1    AMQN01011293    KB308811    ELT96471.1    DS235392    EEB15529.1    KQ976604    KYM79404.1    ADTU01020204    GFDF01011093    JAV02991.1    JH431601    GEZM01101576    GEZM01101573    GEZM01101570    GEZM01101569    GEZM01101566    GEZM01101565    GEZM01101553    GEZM01101549    GEZM01101547    JAV52508.1    GEZM01101567    GEZM01101556    JAV52523.1    GEZM01101579    GEZM01101575    GEZM01101571    GEZM01101568    GEZM01101562    GEZM01101560    GEZM01101559    GEZM01101558    GEZM01101555    GEZM01101554    GEZM01101551    GEZM01101550    GEZM01101548    GEZM01101546    GEZM01101542    GEZM01101541    GEZM01101540    JAV52532.1    GEZM01101578    JAV52495.1    GBHO01045648    GBHO01045647    GBHO01045646    GBHO01021173    GBHO01016799    GBHO01016798    JAF97955.1    JAF97956.1    JAF97957.1    JAG22431.1    JAG26805.1    JAG26806.1    PYGN01002942    PSN29814.1    GEZM01101544    JAV52590.1    GEZM01101577    GEZM01101572    GEZM01101563    GEZM01101561    GEZM01101552    GEZM01101543    JAV52510.1    GBHO01045650    GBHO01045645    GBHO01026686    GBHO01026683    GBHO01026682    GBHO01026681    GBHO01026680    GBHO01026678    JAF97953.1    JAF97958.1    JAG16918.1    JAG16921.1    JAG16922.1    JAG16923.1    JAG16924.1    JAG16926.1    GDHC01006927    JAQ11702.1    GDHC01003801    JAQ14828.1    GDHC01007108    JAQ11521.1    GDIP01133416    JAL70298.1    GECU01011041    JAS96665.1    GECU01032144    JAS75562.1    GGMR01012391    MBY25010.1    GFXV01006195    MBW18000.1    GDIP01087734    JAM15981.1    AAPE02047503    GDIP01064682    JAM39033.1    GDIP01071432    JAM32283.1    KB106579    ELK30970.1    GDIQ01144655    JAL07071.1    GDIP01083775    JAM19940.1    GDIP01085322    JAM18393.1    GDIQ01223723    JAK28002.1    GDIQ01117910    JAL33816.1    GDIQ01044793    JAN49944.1    GDIP01138815    JAL64899.1    GDIQ01020965    JAN73772.1    GDIQ01224974    JAK26751.1    GL732643    EFX69064.1    AAEX03006298    KE164590    EPQ18977.1    GABZ01003675    JAA49850.1   
Pfam
PF00689   Cation_ATPase_C        + More
PF01027   Bax1-I
Interpro
IPR039720   TMEM94        + More
IPR023299   ATPase_P-typ_cyto_dom_N       
IPR023298   ATPase_P-typ_TM_dom_sf       
IPR006068   ATPase_P-typ_cation-transptr_C       
IPR006214   Bax_inhibitor_1-related       
IPR008250   ATPase_P-typ_transduc_dom_A_sf       
SUPFAM
SSF81660   SSF81660        + More
SSF81665   SSF81665       
SSF81653   SSF81653       
Gene 3D

Ontologies

Topology

Length:
214
Number of predicted TMHs:
4
Exp number of AAs in TMHs:
93.62219
Exp number, first 60 AAs:
31.01757
Total prob of N-in:
0.58165
POSSIBLE N-term signal
sequence
inside
1  -  4
TMhelix
5  -  27
outside
28  -  77
TMhelix
78  -  100
inside
101  -  120
TMhelix
121  -  143
outside
144  -  162
TMhelix
163  -  185
inside
186  -  214
 
 

Population Genetic Test Statistics

Pi
30.524814
Theta
31.249941
Tajima's D
-0.797796
CLR
0
CSRT
0.175041247937603
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号