SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16511  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA009779
Annotation
PREDICTED:_unconventional_myosin-Va_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.215 Nuclear   Reliability : 1.213
 

Sequence

CDS
ATGACAACGAAGGAATTGTACACGAAGGGTGCCAGGATATGGGTGGAGCACCCGGAGAAGGTGTGGGAGAGCGCAACAGTAACATCCGACTATCGATCCGGCGTTCTCATCGTGAAACTAGACCAGACAGATGAAATAAGACAAATAACGATCAAAGATGAGAAACACATGCCCCCACTCCGGAACCCGTCGCTCCTCATCGGCCAAAATGATCTCACGTCACTATCGTACCTCCACGAGCCGGCGGTGCTGCATAATCTTAAAGTCAGATTCTGCGATCGTAACGCTATATACACCTACTGCGGGATCGTCCTCGTGGCCATCAATCCTTATTATGATCTTCCGATTTACGGCGATGAAACCATCATGGCGTATCGGGGCCAATCGATGGCGATCTGGACCCTCACATATTCGCCGTCTCCGAAGAGGCCTACACCAAACTGGAGCGAGAAAGGAGTGATCAGAGTATCATAG
Protein
MTTKELYTKGARIWVEHPEKVWESATVTSDYRSGVLIVKLDQTDEIRQITIKDEKHMPPLRNPSLLIGQNDLTSLSYLHEPAVLHNLKVRFCDRNAIYTYCGIVLVAINPYYDLPIYGDETIMAYRGQSMAIWTLTYSPSPKRPTPNWSEKGVIRVS

Summary

Similarity
Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family.
EMBL
RSAL01000015    RVE53164.1    GDQN01007725    JAT83329.1    BABH01017761    BABH01017762    + More
KQ459593    KPI96618.1    NWSH01003935    PCG65662.1    ODYU01000382    SOQ35071.1    GAKP01020936    JAC38016.1    GECZ01014290    JAS55479.1    GECU01024162    JAS83544.1    QCYY01000441    ROT85130.1    GEDC01027118    JAS10180.1    GEDC01028278    GEDC01006987    JAS09020.1    JAS30311.1    GAKP01020935    JAC38017.1    KK117539    KFM70741.1    GBYB01003692    JAG73459.1    GBYB01006959    JAG76726.1    GBXI01008248    JAD06044.1    GBXI01010584    JAD03708.1    JR039293    JR039294    AEY58619.1    AEY58620.1    GDHF01029304    JAI23010.1    GDHF01005267    JAI47047.1    KQ971354    EFA06975.2    GDRN01089957    JAI60556.1    GDRN01089955    JAI60557.1    GAMC01013038    JAB93517.1    GAMC01013037    JAB93518.1    GEZM01031022    JAV85121.1    HACA01031851    CDW49212.1    OUUW01000001    SPP75704.1    SPP75705.1    ADTU01022924    ADTU01022925    CM000071    ENO01762.2    EAL25983.2    CH479223    EDW35042.1    GEDV01000438    JAP88119.1    CH902619    KPU77062.1    KPU77064.1    KQ977279    KYN04261.1    AAZX01001194    RCHS01004059    RMX37998.1    IACF01007993    LAB73576.1    GBXI01007769    JAD06523.1    GL440553    EFN65790.1    KPU77063.1    EDV37870.1    HM212671    ADM15669.1    CH940648    KRF80298.1    GALX01002476    JAB65990.1    GDHF01001133    JAI51181.1    CM002911    KMY92001.1    KRF80299.1    KMY92003.1    CM000157    KRJ98272.1    KRJ98274.1    EDW61877.1    GGFJ01000199    MBW49340.1    CM000362    EDX06023.1    AXCM01004568    CH954177    KQS70943.1    KQS70945.1    CH933808    KRG04530.1    KRJ98273.1    EDW89191.1    KMY92002.1    KMY92004.1    CH480816    EDW46768.1    EDV59678.1    KQS70944.1    CH963719    KRF97440.1    JXJN01012803    EDW71974.1    KRG04531.1    LN830727    CFW94236.1    EDW09224.1    GFDF01000178    JAV13906.1    GFDF01000177    JAV13907.1    CH916367    EDW02584.1    AXCN02000461    JRES01000780    KNC28384.1    AE013599    AAM68903.1    GFJQ02002557    JAW04413.1    BT010003    AAQ22472.1    ENO01761.2    GGFJ01000198    MBW49339.1    GDHC01014778    JAQ03851.1    DS235019    EEB10549.1    KRT02722.1    QOIP01000009    RLU18383.1   
Pfam
PF00063   Myosin_head        + More
PF00612   IQ
PF02736   Myosin_N
PF01843   DIL
Interpro
IPR036961   Kinesin_motor_dom_sf        + More
IPR001609   Myosin_head_motor_dom       
IPR027417   P-loop_NTPase       
IPR008989   Myosin_S1_N       
IPR004009   Myosin_N       
IPR036103   MYSc_Myo5       
IPR000048   IQ_motif_EF-hand-BS       
IPR002710   Dilute_dom       
SUPFAM
SSF50084   SSF50084        + More
SSF52540   SSF52540       
Gene 3D
PDB
1W8J     E-value=1.99773e-42,     Score=428

Ontologies

Topology

Length:
157
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
15.9811
Exp number, first 60 AAs:
1e-05
Total prob of N-in:
0.79159
outside
1  -  157
 
 

Population Genetic Test Statistics

Pi
23.178461
Theta
33.394323
Tajima's D
-0.962899
CLR
0
CSRT
0.144892755362232
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号