SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16508
Pre Gene Modal
BGIBMGA004545
Annotation
PREDICTED:_transcriptional_activator_cubitus_interruptus_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.465 Nuclear   Reliability : 1.193
 

Sequence

CDS
ATGTACAGAACACTTATTTATTCAGGACCGGCACATGCATTAGGAGCGATATCTCCAGCCCTTTCCCTCTCCCATGCTTCGTTGGCCCAACAATTGTTGGCTAGAGGAGGAGTGGTGGGAAGCAGCGGAGTACTGGCCGGAGGCGTACTGCTAGATCCTGCGCATCAACAGGCGGCAGCAGCTGCTGCTCATCATGCCGCTCATGCCCATCTGGTAGCTGGCATTCATAGATCTCACATATCGTCACCGACACAATTGCTCATGGGTCCTGTGGATGTCAGACAGGGCTTGGGACTAGATGGAACCCCTCCTCAGCACCTCCAACAGCCTTCGCAGCAACCTGAAATCACTAGTGTTATGGAAGCTGATAGAATGCGAGCTAAGATCGTATTCTTTGATTTTGTTCCCAAATACTGA
Protein
MYRTLIYSGPAHALGAISPALSLSHASLAQQLLARGGVVGSSGVLAGGVLLDPAHQQAAAAAAHHAAHAHLVAGIHRSHISSPTQLLMGPVDVRQGLGLDGTPPQHLQQPSQQPEITSVMEADRMRAKIVFFDFVPKY

Summary

Uniprot
ProteinModelPortal

Ontologies

GO

Topology

Length:
138
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.98632
Exp number, first 60 AAs:
1.98289
Total prob of N-in:
0.18839
outside
1  -  138
 
 

Population Genetic Test Statistics

Pi
23.74121
Theta
26.363037
Tajima's D
-0.437585
CLR
0
CSRT
0.263186840657967
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号