SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16478
Annotation
PREDICTED:_uncharacterized_protein_LOC105841723_[Bombyx_mori]
Location in the cell
Extracellular   Reliability : 2.114 Nuclear   Reliability : 1.828
 

Sequence

CDS
ATGCTGCAAGTCGCTCTGCAACGTCAAGCTGCAACGTCATGCTGCAAGTCGCTCTGCAACGTCAAGCTGCAACTTCATGCTGCAACGTCGCTCTGCAACGTCAAGCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCAAGCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCATGCTGCAACTTCATGCTGCAACGTCGCTCTGCAACGTCAAGCTGCAACGTCATGCTGCAAGTCGCTCTGCAACGTCAAGCTGCAACTTCATGCTGCAACGTCGCTCTGCAACGTCAAGCTGCAACGTCATGCTGCAAGTCGCTCTGCAACGTCAAGCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATGCTGCAAGTCGCTCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCATGCTGCAACTTCATGCTGCAACGTCATGCTGCAAGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGCTGCAAGTCGCTCTGCAACGTCAGCTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCATGCTGCAAGTCGCTCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATGCTGCAAGTCGCTCTGCAACGTCATGCTGCAAGTCGCTCTGCAACGTCATGCTGCAAGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCAAGCTGCAACGTCGCTCTGCAACGTCAAGCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCATGCTGCAACTTCATGCTGCAACGTCATGCTGCAAGTCGCTCTGCAACGTCAAGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCATGTTGCAACGTCGCTCTGCAACGTCAAGCTGCAACGTCGCTCTGCAACGTCATGCTGCAACGTCGCTCTGCAACGTCAGACAGCCAGACACACCTCGATTTGA
Protein
MLQVALQRQAATSCCKSLCNVKLQLHAATSLCNVKLQRHVATSLCNVMLQRRSATSSCNVMLQRRSATSCCNFMLQRRSATSSCNVMLQVALQRQAATSCCNVALQRQAATSCCKSLCNVKLQRHVATSLCNVMLQRRSATSCCNVMLQVALQRHVATSLCNVMLQLHAATSCCKSLCNVMLQRRSATSCCKSLCNVSSLCNVMLQRRSATSCCNVALQRHAATSCCNVALQRHAASRSATSCCNVALQRHAATSCCKSLCNVMLQVALQRHAASRSATSCCNVALQRHVATSLCNVKLQRRSATSSCNVMLQRRSATSCCNVALQRHVATSLCNVMLQRHVATSLCNVMLQLHAATSCCKSLCNVKLQRRSATSCCNVALQRHVATSLCNVKLQRRSATSCCNVALQRQTARHTSI

Summary

Similarity
Belongs to the WD repeat SEC13 family.
Pfam
PF13306   LRR_5        + More
PF00400   WD40
Interpro
IPR011004   Trimer_LpxA-like_sf        + More
IPR026906   LRR_5       
IPR033201   HRNR       
IPR037597   Nucleoporin_Seh1       
IPR015943   WD40/YVTN_repeat-like_dom_sf       
IPR001680   WD40_repeat       
IPR017986   WD40_repeat_dom       
IPR037363   Sec13/Seh1_fam       
IPR036322   WD40_repeat_dom_sf       
SUPFAM
SSF51161   SSF51161        + More
SSF50978   SSF50978       
Gene 3D

Ontologies

Topology

Length:
417
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00621
Exp number, first 60 AAs:
0.00011
Total prob of N-in:
0.01013
outside
1  -  417
 
 

Population Genetic Test Statistics

Pi
27.251434
Theta
38.658672
Tajima's D
-0.852189
CLR
0.000001
CSRT
0.164191790410479
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号