SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16462
Annotation
reverse_transcriptase_[Lasius_niger]
Location in the cell
Nuclear   Reliability : 2.375
 

Sequence

CDS
ATGATACCTAAAGTAGGGAAGCCAGTGAACGAACTTAGCTCATACAGGCCGATTAGTCTACTAACCGTAACGTCAAAACTTTTTGAGTCAGTCCTGCTGCACAGATTATTGGAGGAGATTCATCAAAGAGCCATAATCCCGGACCACCAGTTTGGCTTTCGCCAGCAGCATGGCACTGTGGAACAAGTCCATAGAATCTGCTCTGTGATAAGGAAGGCAATAGAGAGAAAGGAGTACTGCTCCTCTGCCTTCCTAGACGTGCAGCAAGCGTTTGATAGAGTATGGCACAAAGGTCTCTTGTATAAAGTAAAAACTCTTCTACCCTGTACATTCTTCCCCATCATAAAATCTTATCTAACAGAAAGAATATTTCAAATAAGAGAAGAAGAGTGTACATCGCCATTTCACTCAATCAAAGCTGGTGTACCGCAGGGGTCTGTCCTGGGTCCTGTCTTGTATACCATTTACACATGTGATTTACCACAAAGCGAACATGTTACATTAGCAACATTCGCAGACGATACCGCTGTACTGGCATGTAGCAATTGCCCAAACGAAGCTTCAGACTTCCTACAGACTGGATTGCAAGAAATTGAAACTTGGCTTTCAAAGTGGAGAATAAAAACTAGTGTGACAAAATCCGTTCATGTAACCTTCACCCTCCGTAGAGGAGACTGTCCGCCAGTAACTCTGTGCAATCAACAACTCCCGCAAGAACACTGCGTAAAATACTTGGGAATACACCTTGATAGGAGACTCGTATGGAAACAACACATACAGAAGAAGAGAGAAGAAATCAACCTGAAATACAGAGGACTCTACTGGCTGCTTGGCAGAAATTCCAAGCTGTCAGTAGATAATAAGCTACTCATCTACGAAATGCTCTTGAAACCAATTTGGACATACGGGATTCAACTATGGGGTTCGGCGTGTGACTCTAACATAAATATCATACAGAGGGTTCAAAATTACATCCTGAAACAAATATCGAACTGTCCGTGGTTTATAAAAACATCGGAGATTCATGAACACCTCAAAATCAGGACTGTTAAACAGGAAATCAAGACCTGGAGTATGAAATACAGAAAAAGGCTAGAAATGCATCCTAATAAGCTTGCCACGCAACTAACCACACCGGACCTAATAAATAGGCTTAAAAGGCGACAAATCCTAAGTCTTGATAGACACGGTTGA
Protein
MIPKVGKPVNELSSYRPISLLTVTSKLFESVLLHRLLEEIHQRAIIPDHQFGFRQQHGTVEQVHRICSVIRKAIERKEYCSSAFLDVQQAFDRVWHKGLLYKVKTLLPCTFFPIIKSYLTERIFQIREEECTSPFHSIKAGVPQGSVLGPVLYTIYTCDLPQSEHVTLATFADDTAVLACSNCPNEASDFLQTGLQEIETWLSKWRIKTSVTKSVHVTFTLRRGDCPPVTLCNQQLPQEHCVKYLGIHLDRRLVWKQHIQKKREEINLKYRGLYWLLGRNSKLSVDNKLLIYEMLLKPIWTYGIQLWGSACDSNINIIQRVQNYILKQISNCPWFIKTSEIHEHLKIRTVKQEIKTWSMKYRKRLEMHPNKLATQLTTPDLINRLKRRQILSLDRHG

Summary

EMBL
NWSH01000032    PCG80497.1    PCG80496.1    GEZM01038405    JAV81653.1    GECZ01005368    + More
JAS64401.1    NEVH01020963    PNF20308.1    NEVH01006736    PNF36716.1    GEBQ01030670    JAT09307.1    GEZM01101506    JAV52621.1    LBMM01014395    KMQ85192.1    GEZM01101509    JAV52620.1    GEZM01097906    JAV54051.1    NWSH01007753    PCG62823.1    NEVH01020940    PNF20481.1    NEVH01007393    PNF35987.1    NEVH01007578    PNF35646.1    NEVH01012089    PNF30491.1    NEVH01007841    PNF34974.1    LBMM01012078    KMQ86419.1    NEVH01016302    PNF25823.1    GFDF01007661    JAV06423.1    GBHO01041572    GBHO01041570    GBHO01010553    JAG02032.1    JAG02034.1    JAG33051.1    GBHO01041571    GBHO01005400    GBHO01005396    JAG02033.1    JAG38204.1    JAG38208.1    GAKP01017773    JAC41179.1    PYGN01000192    PSN51582.1    NEVH01006721    PNF37225.1    NEVH01021925    PNF19341.1    NEVH01007402    PNF35856.1    NEVH01016340    PNF25410.1    NEVH01026386    PNF14434.1    GEZM01053022    JAV74219.1    CP012527    ALC48130.1    NEVH01026106    PNF14658.1    NEVH01015305    PNF27092.1    NEVH01012084    PNF30905.1    NEVH01000598    PNF43535.1    GBBI01001658    JAC17054.1    GBHO01021814    GBHO01010549    JAG21790.1    JAG33055.1    KU543673    AMS38352.1    GBHO01010547    GBHO01010546    JAG33057.1    JAG33058.1    NEVH01016327    PNF25684.1    NEVH01023979    PNF17579.1    NEVH01001347    PNF42959.1    LBMM01013518    KMQ85605.1    NEVH01008277    PNF34262.1    LBMM01012041    KMQ86458.1    X17551    CAA35587.1    NEVH01005295    PNF38784.1    NEVH01019963    PNF22185.1    AY508487    AAS13459.1    AY047531    AAK77263.1    M17214    AAA28508.1    GBGD01001540    JAC87349.1    GBBI01001692    JAC17020.1    GBXI01011604    JAD02688.1    GAHY01002426    JAA75084.1    GGMR01003787    MBY16406.1    GGMS01004444    MBY73647.1    NEVH01005885    PNF38441.1    ABLF02041861    GEDC01000337    JAS36961.1    ABLF02035448    GEDC01015644    JAS21654.1    DNOY01000259    HBE18313.1    ABLF02022943    ABLF02046958    ABLF02036794    GGMS01009480    MBY78683.1    GGMR01018428    MBY31047.1    KU543685    AMS38375.1    GBBI01001570    JAC17142.1    LBMM01018951    KMQ83660.1    GBBI01001699    JAC17013.1    ABLF02028354    ABLF02028357    ABLF02062343    GBGD01000880    JAC88009.1    GGMR01000005    MBY12624.1    GBGD01000799    JAC88090.1    GBHO01008295    JAG35309.1    ABLF02049474    GGMS01001277    MBY70480.1    GFTR01008261    JAW08165.1    ABLF02022879    LBMM01010106    KMQ87671.1    ABLF02023279    ABLF02041474    GGMR01000226    MBY12845.1    GFTR01008151    JAW08275.1    ABLF02041284    GGMS01002441    MBY71644.1    GGMR01010373    MBY22992.1    ABLF02020350    GBGD01000881    JAC88008.1    GFXV01002840    MBW14645.1    ABLF02015541    GGMR01011511    MBY24130.1    GGMR01006491    MBY19110.1    GGMR01016114    MBY28733.1    GBBI01001642    JAC17070.1    GBBI01003747    JAC14965.1    GEZM01084969    JAV60363.1    GBBI01001646    JAC17066.1    KU543687    AMS38379.1    GGMR01000857    MBY13476.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF07530   PRE_C2HC
PF03372   Exo_endo_phos
PF12259   Baculo_F
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR006579   Pre_C2HC_dom       
IPR022048   Envelope_fusion-like       
SUPFAM
SSF56219   SSF56219       
Gene 3D
PDB
5G2X     E-value=0.0116188,     Score=91

Ontologies

Topology

Length:
397
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.12681
Exp number, first 60 AAs:
0.02088
Total prob of N-in:
0.01005
outside
1  -  397
 
 

Population Genetic Test Statistics

Pi
185.767571
Theta
125.956493
Tajima's D
1.457103
CLR
0.763327
CSRT
0.776011199440028
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号