SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16421
Pre Gene Modal
BGIBMGA013829
Annotation
UDP-glycosyltransferase_UGT33D8_[Bombyx_mori]
Full name
UDP-glucuronosyltransferase      
Location in the cell
Cytoplasmic   Reliability : 2.168
 

Sequence

CDS
ATGAAATTGTATTTTTTTGTGATTTGTTTGACGTATGGGAGTGAAGCGGCAAGGATTTTGGGAATATTCCCGACACCCTCAATAAGTCATCAAGTGGCTTTCCGACCTTTGACCTTGGAGCTGGCGAAAAGAGGCCACGAGCTTGTCGTTCTCACGACTGATCCTGTCTTCGCTAAGGGGAGCTCACCAGAAAACTACACAGAGATAGACGTTCACGACATGTCCTATGAGACATGGAGGAAAGGGTTTTCGGCAACGAGTAAAGGAAGAACTGACGATATTTTCGAGCAGTTAACGAGAATATTTGATTTAATTCCAAAGATTTTCGTGAAACAATTTCTGACGGACGAATTCCAGGAAGTATTGAAAAGCGAAAAGAAATTCGATTTGCTGATTATAGAGGCAATTGTGAGACCGGCAATAATACTAGGTCATGTCTTCAACGCGCCCGTAGTTCTCATGAGTTCCCTGGGCGGTTTCCGAGATATTTATGACATATTTGGGGCCCCAAATCATCCGCTTCTTTATCCAGCTGTAACGCGGCAAAAACTTTACGATCTAACGTATTGGGAAAAGTTAAGGGAGATGTACAGCCATTATACCGTTGAACGCATATGGAAAGAGTTCGAAGAGAAGGATAATGAGCTGGTTACGAGCGTCTTTGGCACCAATGTCCCAAGTCTAAGCGAAATGATGGATAGAATCAGTTTGATACTGTTGAACGTTCATCCAATTTGGGAAAACAATCGTCCGGTTCCACCGAATATTATTTACGTTGGAGGAATCCATCAGAAACCACAACAGGATTTGCCTTCGGATTTAAAAGCCTACCTAGATGCATCGAGACACGGTGTTATTTTCATAAGTTTTGGCACCAACGTCATGCCTTCTGCGTTACCACAAGAACGAATCCAAACCCTGATCAAAGCGTTCTCTCAATTACCCTACGATGTGCTCTGGAAATGGGACAAAGATGAGTTGCCCGGAAGATCGAAAAATATTAGAATATCAAAGTGGCTACCACAACCTGATTTACTCAGGCATCCAAAGGTCAAGCTATTTATAACTCAAGGCGGTCTGCAGTCAACGGAAGAAGCGATCACGGCTGGAGTACCCCTGATTGGGATGCCGATGTTGGGAGACCAGTGGTACAACGTGGAACAGTACGTGAAACATAGAATCGGATTAAGACTGGACATGGACGATCTTTCTGAAGATAAATTACAGAACTCCATTAAAGAGATAATTAACGATGAAAGGTAA
Protein
MKLYFFVICLTYGSEAARILGIFPTPSISHQVAFRPLTLELAKRGHELVVLTTDPVFAKGSSPENYTEIDVHDMSYETWRKGFSATSKGRTDDIFEQLTRIFDLIPKIFVKQFLTDEFQEVLKSEKKFDLLIIEAIVRPAIILGHVFNAPVVLMSSLGGFRDIYDIFGAPNHPLLYPAVTRQKLYDLTYWEKLREMYSHYTVERIWKEFEEKDNELVTSVFGTNVPSLSEMMDRISLILLNVHPIWENNRPVPPNIIYVGGIHQKPQQDLPSDLKAYLDASRHGVIFISFGTNVMPSALPQERIQTLIKAFSQLPYDVLWKWDKDELPGRSKNIRISKWLPQPDLLRHPKVKLFITQGGLQSTEEAITAGVPLIGMPMLGDQWYNVEQYVKHRIGLRLDMDDLSEDKLQNSIKEIINDER

Summary

Catalytic Activity
glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP
Similarity
Belongs to the UDP-glycosyltransferase family.
Feature
chain  UDP-glucuronosyltransferase
EC Number
2.4.1.17
EMBL
BABH01029271    JQ070236    AEW43152.1    FJ418685    ACJ48963.1    JQ070235    + More
AEW43151.1    JQ070234    AEW43150.1    BABH01029273    BABH01029274    JQ070231    AEW43147.1    BABH01029259    BABH01029260    JQ070230    AEW43146.1    BABH01029269    BABH01029270    JQ070233    AEW43149.1    HQ833816    ADY17534.1    JQ070229    AEW43145.1    JQ070232    AEW43148.1    DQ443275    ABF51364.1    JQ747500    AGG36457.1    KZ150193    PZC72373.1    JQ070200    AEW43116.1    KU680282    ANI21988.1    ODYU01006890    SOQ49139.1    JTDY01001352    KOB74102.1    KF777109    AHY99680.1    KZ150704    PZC70374.1    KZ150360    PZC71190.1    PZC70375.1    PZC71192.1    JQ070202    AEW43118.1    JQ070193    AEW43109.1    KY304474    AUN86405.1    KY202933    AUC64277.1    PZC71189.1    JQ070189    AEW43105.1    PZC71191.1    NWSH01005967    PCG63789.1    ODYU01010933    SOQ56350.1    JQ070199    AEW43115.1    KY202945    AUC64289.1    PZC71193.1    GEYN01000079    JAV02050.1    JQ070194    AEW43110.1    KF777111    AHY99682.1    PZC71199.1    PZC71200.1    KU680280    ANI21986.1    JQ070197    AEW43113.1    JQ070196    AEW43112.1    PZC71196.1    ODYU01004485    SOQ44409.1    KU680281    ANI21987.1    KU680287    ANI21993.1    PZC71194.1    PZC71197.1    KU680288    ANI21994.1    JQ070190    AEW43106.1    KF777112    AHY99683.1    KU680284    ANI21990.1    PZC71195.1    KQ459547    KPJ00048.1    JQ070195    AEW43111.1    PZC72371.1    JQ070201    AEW43117.1    PZC71201.1    KPJ00045.1    PZC71198.1    KU680289    ANI21995.1    JQ070191    AEW43107.1    KF777110    AHY99681.1    PZC72369.1    KPJ00043.1    NWSH01000435    PCG76447.1    KU680286    ANI21992.1    KU680283    ANI21989.1    JQ070192    AEW43108.1    KU214506    AMK97472.1    ODYU01004546    SOQ44549.1    BABH01029272    KQ459937    KPJ19195.1    JQ070198    AEW43114.1    PZC71202.1    KU680291    ANI21997.1    KZ149974    PZC75964.1    JQ070204    AEW43120.1    GEYN01000093    JAV02036.1    PZC72370.1    ODYU01010294    SOQ55304.1    SOQ44548.1    JQ070238    AEW43154.1    ODYU01001030    SOQ36683.1    KU680285    ANI21991.1    KU680290    ANI21996.1    KPJ19193.1    ODYU01005543    SOQ46493.1    KPJ00042.1    KQ459680    KPJ20473.1    KPJ00041.1    GQ915324    ACZ97418.2    GEYN01000099    JAV02030.1    JQ070237    AEW43153.1    AGBW02009962    OWR49474.1   
Pfam
PF00201   UDPGT
Interpro
IPR035595   UDP_glycos_trans_CS        + More
IPR002213   UDP_glucos_trans       
IPR006326   UDPGT_MGT       
PDB
2O6L     E-value=1.52045e-24,     Score=280

Ontologies

Topology

Subcellular location
Membrane  
SignalP
Position:   1 - 16,         Likelihood:  0.979258
 
 
Length:
420
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.0755
Exp number, first 60 AAs:
0.48504
Total prob of N-in:
0.03992
outside
1  -  420
 
 

Population Genetic Test Statistics

Pi
174.875167
Theta
160.394171
Tajima's D
0.35351
CLR
0
CSRT
0.472176391180441
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号