SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16419
Pre Gene Modal
BGIBMGA013831
Annotation
UDP-glycosyltransferase_UGT33D2_precursor_[Bombyx_mori]
Full name
UDP-glucuronosyltransferase      
Location in the cell
Cytoplasmic   Reliability : 1.534
 

Sequence

CDS
ATGAAGCTAATTTTACTGGTGTGTTTATCAGTGATTAATGCCAATGAAGCGGCCCGGATCCTGTGCGTTTTTCCAATACCTTCAATCAGCCATCAATTGGCCTTCCGACCATTACCATTAGAGCTAGCAAAACGGGGCCACGAGTTAACCGTTCTCACGACTGATCCTATCTTTACTGAAGGCCAATCCCCTGAAAACTATACAGAAATAGACGTCCACGACGTATCTTACGATGCCTGGAAGAAAGGTTTCCTGCAGACGTCAAGAGGAAAATCTCAAGATATTTTCGAACAAGCTAGAGTTGCAATGACTGTTATAAGTAAAGTTGTCGCGAAACAATTACAGACCGACGAATTTGAGGCGGTTTTGAAGGGCGCAAAAAAATTTGATTTGCTAATTATCGAAGCCCCTGTTAAAATACCTAGGATACTCAGTCACATTCTGGGCGCACCCATGATACTTATGAGTTCTATGGGCGGAGCCTGGGATCTTTACGACATTGTCGGAGCACCAAGCCATCCACTGTTATATCCCGATTTGTTAGCCCAAAGATTAGATAATCTAACGTTATGGGAAAAGCTACACCAGTTATACAACTACTATTCATTTGTAAGTTTGTTTGATAAGCTGGAGATCGAGGATGATGTGCTGATTAAGAGTATTTTTGGGCCGACGATGCCAAAATTAAGTGAAATGAGGAATAATGTTGAGTTGGTGCTGTTGACAACGCATCGCATTTGGGAACACAATCGTCCGGTTCCACCCAATCTTATTTACGTTGGAGGAATTCATCAGATGCCACAAAAAGAACTGCCTTCGGATCTCAAAGTCTTCTTAGATTCATCTCAACACGGAGTTATATACATAAGTTTCGGCACCAATGTTTTACCTTCGCTGTTGCCACCAGAACGGATCCGAATTTTGGTAAAAGTTTTTTCTGAACTACCCTACGATGTGCTGTGGAAGTGGGACAAAGATGAACTTCCCGGAAGATCGAAAAACATCAGGATCTCCAAGTGGCTACCACAATCTGATTTACTTAGGCATCCAAAAATAAAACTCTTCATAACCCAAGGTGGTCTGCAGTCAACAGAAGAAGCGATCACTGCGGGAGTTCCCCTAATTGGGGTGCCGATGTTGGGTGACCAGTGGTGCAACGTAGAACAGTACGTGAGACACAGAATTGGACTAAGACTTGACTTGGATGAGCTATCTGAAGATAAACTGAGGAGTTTCATTGAAGAGATCATTAATGATCAAAGCTATCGTCAGAACATAGCTCGTCTCCGGAGCCAGGTGTACGACCAGCCTCTGAGCTCGTTGGAGCGCGCCGTGTGGTGGACGGAGCACGTGCTGCGTCACGGAGGAGCCCAGCATCTCCGAGCTGCCGGCGCCAATCTATCCTGGTCACAATACTTGGAACTGGAACTTGTTTCAGTATTGCTTATCGCTTTTGTTTTTTTATGA
Protein
MKLILLVCLSVINANEAARILCVFPIPSISHQLAFRPLPLELAKRGHELTVLTTDPIFTEGQSPENYTEIDVHDVSYDAWKKGFLQTSRGKSQDIFEQARVAMTVISKVVAKQLQTDEFEAVLKGAKKFDLLIIEAPVKIPRILSHILGAPMILMSSMGGAWDLYDIVGAPSHPLLYPDLLAQRLDNLTLWEKLHQLYNYYSFVSLFDKLEIEDDVLIKSIFGPTMPKLSEMRNNVELVLLTTHRIWEHNRPVPPNLIYVGGIHQMPQKELPSDLKVFLDSSQHGVIYISFGTNVLPSLLPPERIRILVKVFSELPYDVLWKWDKDELPGRSKNIRISKWLPQSDLLRHPKIKLFITQGGLQSTEEAITAGVPLIGVPMLGDQWCNVEQYVRHRIGLRLDLDELSEDKLRSFIEEIINDQSYRQNIARLRSQVYDQPLSSLERAVWWTEHVLRHGGAQHLRAAGANLSWSQYLELELVSVLLIAFVFL

Summary

Catalytic Activity
glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP
Similarity
Belongs to the UDP-glycosyltransferase family.
Belongs to the peptidase S1 family.
Feature
chain  UDP-glucuronosyltransferase
EC Number
2.4.1.17
EMBL
JQ070230    AEW43146.1    BABH01029269    BABH01029270    JQ070231    AEW43147.1    + More
BABH01029271    JQ070236    AEW43152.1    FJ418685    ACJ48963.1    JQ070235    AEW43151.1    JQ070234    AEW43150.1    BABH01029273    BABH01029274    BABH01029259    BABH01029260    JQ070233    AEW43149.1    JQ070232    AEW43148.1    HQ833816    ADY17534.1    JQ070229    AEW43145.1    DQ443275    ABF51364.1    JQ747500    AGG36457.1    KZ150360    PZC71192.1    JQ070200    AEW43116.1    KZ150193    PZC72373.1    ODYU01006890    SOQ49139.1    KF777111    AHY99682.1    PZC71191.1    PZC71199.1    JQ070189    AEW43105.1    KU680287    ANI21993.1    PZC71190.1    JQ070193    AEW43109.1    JTDY01001352    KOB74102.1    ODYU01004485    SOQ44409.1    JQ070190    AEW43106.1    JQ070202    AEW43118.1    PZC71189.1    ODYU01010933    SOQ56350.1    KZ150704    PZC70375.1    ODYU01004546    SOQ44548.1    JQ070199    AEW43115.1    PZC70374.1    KU680284    ANI21990.1    NWSH01005967    PCG63789.1    KU680289    ANI21995.1    KU680280    ANI21986.1    PZC71194.1    KU680282    ANI21988.1    JQ070194    AEW43110.1    PZC71193.1    NWSH01000435    PCG76447.1    PZC71195.1    KF777109    AHY99680.1    KU680281    ANI21987.1    PZC71196.1    JQ070192    AEW43108.1    PZC71200.1    KU214506    AMK97472.1    PZC72369.1    PZC71201.1    JQ070198    AEW43114.1    JQ070196    AEW43112.1    JQ070195    AEW43111.1    JQ070201    AEW43117.1    PZC71202.1    PZC72371.1    PZC71198.1    JQ070197    AEW43113.1    JQ070191    AEW43107.1    PZC71197.1    JQ070204    AEW43120.1    KU680288    ANI21994.1    KZ149974    PZC75964.1    KQ459547    KPJ00048.1    KPJ00043.1    KQ459937    KPJ19195.1    KF777110    AHY99681.1    KU680283    ANI21989.1    KY304474    AUN86405.1    PZC72370.1    KF777112    AHY99683.1    JQ070238    AEW43154.1    SOQ44549.1    KY202945    AUC64289.1    KY202933    AUC64277.1    KU680291    ANI21997.1    KU680285    ANI21991.1    ODYU01001030    SOQ36683.1    GEYN01000079    JAV02050.1    KU680286    ANI21992.1    KU680290    ANI21996.1    JQ070203    AEW43119.1    KPJ00042.1    ODYU01005543    SOQ46493.1    PZC72372.1    KPJ00041.1    ODYU01010294    SOQ55304.1    JQ070237    AEW43153.1    GEYN01000099    JAV02030.1    GQ915324    ACZ97418.2    PCG76446.1    KQ459680    KPJ20473.1    BABH01029238    BABH01029239    BABH01029240    BABH01029272    KPJ00052.1   
Pfam
PF00201   UDPGT        + More
PF00089   Trypsin
Interpro
IPR035595   UDP_glycos_trans_CS        + More
IPR002213   UDP_glucos_trans       
IPR006326   UDPGT_MGT       
IPR033116   TRYPSIN_SER       
IPR001314   Peptidase_S1A       
IPR009003   Peptidase_S1_PA       
IPR001254   Trypsin_dom       
IPR018114   TRYPSIN_HIS       
SUPFAM
SSF50494   SSF50494       
PDB
2O6L     E-value=9.03299e-27,     Score=300

Ontologies

Topology

Subcellular location
Membrane  
SignalP
Position:   1 - 14,         Likelihood:  0.983392
 
 
Length:
488
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.5355
Exp number, first 60 AAs:
0.20699
Total prob of N-in:
0.01233
outside
1  -  488
 
 

Population Genetic Test Statistics

Pi
162.081881
Theta
204.237309
Tajima's D
-0.870184
CLR
42.260708
CSRT
0.162841857907105
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号