SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16368
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.552
 

Sequence

CDS
ATGGAGTGGACGCTTAAAGAAGACCGTGTTGCAGTTATTGCGTTGCATCGTTGCGGTTACGCGCCATTTAAAATTTTTAACATACTGAAAAATTTGAATATAACCAAAAGATTCGCTTATCGTACCATCAAACGATACAATGAAGACTCTAGTGCAGATGACAGGTCAAGAAGTGGTCGCCCTCGGTCTGTTAGGACTCCAGCAGTGATAAAAGCTGTGAAGGTGCGAATTCAAAGAAATCCCAAACCTCATAGAGCGAAGAGCACACAAGACTGGCTGGTGGCGCGTGAAATCGACTTCATGCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGTTAGATTACAAGATATGGCAACACTTAGAGGAAAAGGCGCGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCTTTGATTAAGGCAGCCGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCTGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGGTCATTTTGAATAA
Protein
MEWTLKEDRVAVIALHRCGYAPFKIFNILKNLNITKRFAYRTIKRYNEDSSADDRSRSGRPRSVRTPAVIKAVKVRIQRNPKPHRAKSTQDWLVAREIDFMRHEDWPSSSPDLNPLDYKIWQHLEEKARSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWLRRLKACIQNHGGHFE

Summary

Pfam
PF13358   DDE_3
Interpro
IPR009057   Homeobox-like_sf        + More
IPR038717   Tc1-like_DDE_dom       
IPR036388   WH-like_DNA-bd_sf       
SUPFAM
SSF46689   SSF46689       
Gene 3D
PDB
5CR4     E-value=0.00103972,     Score=95

Ontologies

Topology

Length:
178
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.05819
Exp number, first 60 AAs:
1.05819
Total prob of N-in:
0.18393
outside
1  -  178
 
 

Population Genetic Test Statistics

Pi
78.21155
Theta
49.527895
Tajima's D
1.988066
CLR
0.038354
CSRT
0.88145592720364
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号