Gene

KWMTBOMO16335

Pre Gene Modal

BGIBMGA013784

Annotation

uncharacterized_protein_LOC767623_[Bombyx_mori]

Location

Bomo_Chr28(+):5619569-5623911      View in EpiBrowser

Full name

Protein IMPACT-B       + More
Protein IMPACT      

Alternative Name

Imprinted and ancient gene protein homolog B
Imprinted and ancient gene protein homolog
Imprinted and ancient gene protein
Ximpact

Location in the cell

Nuclear   Reliability : 2.59

CDS

ATGGAAGTCGACAACTTATCAAGACAGGTTGAAGAAATTGAAGCTTTAAAATCTATTTACACAGAAGAATTGACTATAGATAGTGAAATTACCAGGTCTTATACTATTAGAATTGAAGAAAATAAGAAAGAAGTGCTTCTTTACGTGACATTACCAGAAGATTACCCGTCGAGTTCTCCACCGAAATTCGAATTGTCTGCACCGTGGATGGACCGACAAACCAAAACGAATCTTCACAAAACCTTGCACGAAATATACTTGGATAACGTCGGTGAAACTGTGATATTTCAATGGGTCGAGATGATAAGGGAAGTGTTACAAACCGTATGCAAAGTAGAAAAAAAAATTGAAGTCACGGAACCTAAAGTCGACAGTTTGGATCTCACTACGATAGAAATAAACTGCCCTGAAATTACACATGGTGAAATCATAGCAGACAGGAAGAGCATATTCCAAGGACATGCAGCTGAAGTACACAGTATAGATGATGTAAAAGCTGTACTAAATAAATTAAAACAGAACAGAAAGATCTTAAATGCTACACATAATATGTATGCATATAGAATAGAAAGAAAAACTGCCAAAGGTACGAATGTACTTCAAGACTGTGATGATGACGGGGAAGCTCACGCCGGAGGTAGAATGTTGCATCTACTGCAAGTTTTGAATCAGAAGAACACACTTGTTGTTGTGTCGAGATGGTATGGAGGAGTACAATTAGGGCCGGACAGATTCCGTCACATAAACAATGCAAGCCGACAAGTGATTCAGCAAGCTGGACTATTAAAGAAATGA

Protein

MEVDNLSRQVEEIEALKSIYTEELTIDSEITRSYTIRIEENKKEVLLYVTLPEDYPSSSPPKFELSAPWMDRQTKTNLHKTLHEIYLDNVGETVIFQWVEMIREVLQTVCKVEKKIEVTEPKVDSLDLTTIEINCPEITHGEIIADRKSIFQGHAAEVHSIDDVKAVLNKLKQNRKILNATHNMYAYRIERKTAKGTNVLQDCDDDGEAHAGGRMLHLLQVLNQKNTLVVVSRWYGGVQLGPDRFRHINNASRQVIQQAGLLKK

Description

Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. Plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.
Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis (PubMed:15937339, PubMed:23447528, PubMed:24333428). May be required to regulate translation in specific neuronal cells under amino acid starvation conditions by preventing GCN2 activation and therefore ATF4 synthesis (PubMed:15937339, PubMed:23447528). Through its inhibitory action on EIF2AK4/GCN2, plays a role in differentiation of neuronal cells by stimulating neurite outgrowth (PubMed:23447528).
Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative regulator of the EIF2AK4/GCN2 kinase activity; impairs GCN1-mediated EIF2AK4/GCN2 activation, and hence EIF2AK4/GCN2-mediated eIF-2-alpha phosphorylation and subsequent down-regulation of protein synthesis. May be required to regulate translation in specific neuronal cells under amino acid starvation conditions by preventing GCN2 activation and therefore ATF4 synthesis. Through its inhibitory action on EIF2AK4/GCN2, plays a role in differentiation of neuronal cells by stimulating neurite outgrowth.

Subunit

Interacts with GCN1; prevents the interaction of GCN1 with EIF2AK4/GCN2 and inhibits EIF2AK4/GCN2 kinase activity. Interaction with RPL39; this interaction occurs in a GCN1-independent manner. Associates with ribosomes; this interaction occurs in a GCN1-independent manner. Associates with actin; this interaction occurs in a GCN1-independent manner.
Interacts with GCN1; prevents the interaction of GCN1 with EIF2AK4/GCN2 and inhibits EIF2AK4/GCN2 kinase activity (PubMed:15937339, PubMed:22404850). Interaction with RPL39; this interaction occurs in a GCN1-independent manner (PubMed:22404850). Associates with ribosomes; this interaction occurs in a GCN1-independent manner (PubMed:22404850). Associates with actin; this interaction occurs in a GCN1-independent manner (PubMed:22404850).

Miscellaneous

The Impact locus is imprinted. Paternal inherited gene is expressed, while the maternal inherited gene is silenced. In contrast with most imprinted genes, neighboring genes are apparently not imprinted.
In contrast to the mouse or rabbit ortholog, the IMPACT locus is not imprinted in Xenopus.
In contrast to the mouse or rabbit ortholog, the IMPACT locus is not imprinted in human.

Similarity

Belongs to the IMPACT family.

Keywords

Complete proteome   Cytoplasm   Differentiation   Neurogenesis   Reference proteome   Repressor   Stress response   Translation regulation   Actin-binding   Phosphoprotein   Alternative splicing   Polymorphism  

Feature

chain  Protein IMPACT-B
splice variant  In isoform 2.
sequence variant  In dbSNP:rs544203385.

Uniprot

Q09GQ0   A0A2A4J6F7   A0A194PWI8   A0A0N1PH62   S4PIS9   A0A2W1BDF3   + More
A0A3S2M6M4   A0A1E1W1K1   A0A212EV50   A0A212FL81   A0A3S2TQA1   A0A2H1VSM6   A0A3S2NHD8   A0A2J7QAC0   A0A1B6MFS3   K7INC1   A0A232EYU5   A0A1B6H196   A0A1B6HJJ2   A0A067RFM4   A0A0P4VWR0   D6WDT9   A0A165A7X1   E9FS84   A0A0P5YWC1   A0A0P6A7F8   A0A1Y1L1R2   A0A2K6U666   F1R3T9   A9UMG5   Q642J4   G3MPG5   A0A210QJE4   X2ASX8   V9L780   A0A293LFS6   A0A0K2TUG2   A0A3B4D019   H2ZPV9   A0A3P8Y0S6   W5LQA6   M3XHQ1   O55091   A0A0B6ZR41   Q5GFD9   V5I0D4   C1BWA3   A0A0L8FJD8   Q9W625   A0A3P8ZWC6   C1BN26   A0A2K5IF79   A0A2T7NJI9   A0A3Q0K081   A0A0E9X3G9   F6YSG2   F1SBA9   B7Q5D7   A0A2K6F3L4   A0A2U9C3Q9   U3DNP8   A0A286XFC7   C3XUC8   A0A2K5DXS6   A0A2K5SAQ2   A0A2K6U633   H3DJU3   A0A2K5DY20   A0A3P8Y2L8   A0A3P8UVY6   A0A3Q2Z351   F6WEH8   A0A3P8UUB8   A0A2K6K7L7   M3XF26   A0A224Z2A1   A0A3Q1IQL6   A0A0D9RYX5   A0A3B3ITH3   G1R485   A0A2K6EAC3   A0A2K5VX90   A0A2K6QJ74   F6RUS8   A0A024RC24   A0A2Y9PH39   G9K5R0   H0X0N8   Q9P2X3   A0A2K5YRE8   A0A2K5MYL9   W5PBP5   L7MD96   A0A131X6P0   A0A096NDH1   A0A3B5LUN8   H2NW26   A0A2U4AYK2   A0A3Q7VSE9   H2UUE3  

Pubmed

19121390    26354079    23622113    28756777    22118469    20075255    + More
28648823    24845553    18362917    19820115    21292972    28004739    22216098    28812685    23254933    24402279    25069045    25329095    9215903    9256468    11116084    15489334    16141072    15871461    15937339    18260151    19131326    21183079    22404850    23447528    24333428    15752730    22673903    25765539    20433749    10066441    25613341    12481130    15114417    30723633    25243066    21993624    18563158    15496914    24487278    20431018    17975172    28797301    16177791    21269460    24275569    25362486    17431167    25319552    11181995    23236062    11244491    14702039    27607563    20809919    25576852    28049606    21551351   

EMBL

BABH01025368    DQ904009    ABI73987.1    NWSH01002936    PCG67258.1    KQ459588    + More
KPI97736.1    KQ461053    KPJ09932.1    GAIX01000084    JAA92476.1    KZ150137    PZC72978.1    RSAL01000025    RVE52167.1    GDQN01010283    JAT80771.1    AGBW02012254    OWR45337.1    AGBW02007882    OWR54449.1    RVE52166.1    ODYU01004197    SOQ43808.1    RSAL01004541    RVE40129.1    NEVH01016331    PNF25509.1    GEBQ01005213    JAT34764.1    NNAY01001603    OXU23457.1    GECZ01001351    JAS68418.1    GECU01032842    JAS74864.1    KK852498    KDR22562.1    GDRN01091016    JAI60350.1    KQ971323    EFA00826.2    LRGB01000642    KZS17280.1    GL732523    EFX89990.1    GDIP01052366    JAM51349.1    GDIP01033702    JAM70013.1    GEZM01068881    JAV66718.1    BC165237    AAI65237.1    BC157649    BC081507    BC152160    JO843766    AEO35383.1    NEDP02003383    OWF48806.1    AMQN01000480    JW875148    AFP07665.1    GFWV01000815    MAA25545.1    HACA01012317    CDW29678.1    AFYH01028777    AFYH01028778    AFYH01028779    AFYH01028780    AFYH01028781    AFYH01028782    AFYH01028783    AFYH01028784    AFYH01028785    AFYH01028786    D87973    AF232228    BC020524    AK138136    HACG01024244    CEK71109.1    AY574213    GANP01002016    JAB82452.1    BT078882    ACO13306.1    KQ430417    KOF64181.1    AB020319    BC099309    BT076005    ACO10429.1    PZQS01000012    PVD21327.1    GBXM01011551    JAH97026.1    AEMK02000045    DQIR01210929    DQIR01257274    HDB66406.1    HDC12752.1    ABJB010692574    ABJB010960445    DS860803    EEC14059.1    CP026254    AWP11244.1    GAMT01005245    GAMS01000982    GAMR01000090    GAMR01000066    GAMQ01005502    GAMP01003743    GAMP01003742    JAB06616.1    JAB22154.1    JAB33842.1    JAB36349.1    JAB49012.1    AAKN02020636    AAKN02020637    GG666464    EEN68502.1    AAMC01131372    AAMC01131373    AAMC01131374    AAMC01131375    AANG04003548    GFPF01009076    MAA20222.1    AQIB01129095    AC007922    ADFV01007067    ADFV01007068    AQIA01032710    JSUE03019320    JU335330    JU335331    JU476283    JV047564    AFE79083.1    AFH33087.1    AFI37635.1    CH471088    EAX01187.1    JP011637    AES00235.1    AAQR03029173    AAQR03029174    AAQR03029175    AAQR03029176    AAQR03029177    AF232229    AB026264    AF208694    AK292533    AC020937    BC034016    BC036074    AMGL01066563    GACK01003237    JAA61797.1    GEFH01005177    JAP63404.1    AHZZ02012425    ABGA01240443    ABGA01240444    NDHI03003366    PNJ81019.1   

Proteomes

UP000005204    UP000218220    UP000053268    UP000053240    UP000283053    UP000007151    + More
UP000235965    UP000002358    UP000215335    UP000027135    UP000007266    UP000076858    UP000000305    UP000233220    UP000008143    UP000000437    UP000242188    UP000261440    UP000007875    UP000265140    UP000018467    UP000008672    UP000000589    UP000002494    UP000053454    UP000233080    UP000245119    UP000008144    UP000008227    UP000001555    UP000233160    UP000246464    UP000008225    UP000005447    UP000001554    UP000233020    UP000233040    UP000007303    UP000265120    UP000264820    UP000233180    UP000011712    UP000265040    UP000029965    UP000005640    UP000001073    UP000233120    UP000233100    UP000233200    UP000006718    UP000248483    UP000005225    UP000233140    UP000233060    UP000002356    UP000028761    UP000261380    UP000001595    UP000245320    UP000286642    UP000005226   

PRIDE

Q09GQ0    O55091    Q5GFD9    F1SBA9    A0A024RC24    Q9P2X3    + More

Pfam

PF01205   UPF0029        + More
PF05773   RWD
PF00839   Cys_rich_FGFR

Interpro

IPR001498   Impact_N        + More
IPR020568   Ribosomal_S5_D2-typ_fold       
IPR006575   RWD-domain       
IPR023582   Impact       
IPR036956   Impact_N_sf       
IPR016135   UBQ-conjugating_enzyme/RWD       
IPR020569   UPF0029_Impact_CS       
IPR001893   Cys-rich_GLG1_repeat       
IPR017873   Cys-rich_GLG1_repeat_euk       
IPR039728   GLG1       

SUPFAM

SSF54211   SSF54211        + More
SSF54495   SSF54495       

Gene 3D

3.10.110.10     3.30.230.30    

ProteinModelPortal

Q09GQ0   A0A2A4J6F7   A0A194PWI8   A0A0N1PH62   S4PIS9   A0A2W1BDF3   + More
A0A3S2M6M4   A0A1E1W1K1   A0A212EV50   A0A212FL81   A0A3S2TQA1   A0A2H1VSM6   A0A3S2NHD8   A0A2J7QAC0   A0A1B6MFS3   K7INC1   A0A232EYU5   A0A1B6H196   A0A1B6HJJ2   A0A067RFM4   A0A0P4VWR0   D6WDT9   A0A165A7X1   E9FS84   A0A0P5YWC1   A0A0P6A7F8   A0A1Y1L1R2   A0A2K6U666   F1R3T9   A9UMG5   Q642J4   G3MPG5   A0A210QJE4   X2ASX8   V9L780   A0A293LFS6   A0A0K2TUG2   A0A3B4D019   H2ZPV9   A0A3P8Y0S6   W5LQA6   M3XHQ1   O55091   A0A0B6ZR41   Q5GFD9   V5I0D4   C1BWA3   A0A0L8FJD8   Q9W625   A0A3P8ZWC6   C1BN26   A0A2K5IF79   A0A2T7NJI9   A0A3Q0K081   A0A0E9X3G9   F6YSG2   F1SBA9   B7Q5D7   A0A2K6F3L4   A0A2U9C3Q9   U3DNP8   A0A286XFC7   C3XUC8   A0A2K5DXS6   A0A2K5SAQ2   A0A2K6U633   H3DJU3   A0A2K5DY20   A0A3P8Y2L8   A0A3P8UVY6   A0A3Q2Z351   F6WEH8   A0A3P8UUB8   A0A2K6K7L7   M3XF26   A0A224Z2A1   A0A3Q1IQL6   A0A0D9RYX5   A0A3B3ITH3   G1R485   A0A2K6EAC3   A0A2K5VX90   A0A2K6QJ74   F6RUS8   A0A024RC24   A0A2Y9PH39   G9K5R0   H0X0N8   Q9P2X3   A0A2K5YRE8   A0A2K5MYL9   W5PBP5   L7MD96   A0A131X6P0   A0A096NDH1   A0A3B5LUN8   H2NW26   A0A2U4AYK2   A0A3Q7VSE9   H2UUE3  

PDB

6BQI     E-value=3.99256e-27,     Score=300

KEGG

767623    no KO assigned | (RefSeq) uncharacterized LOC767623

GO

GO:0097201   GO:0060548   GO:0005737   GO:0072755   GO:0071264   GO:0060733   GO:1990138   GO:1990253   GO:0042149   GO:0071468   GO:0071494   GO:0031333   GO:0001933   GO:0000122   GO:0070301   GO:0045666   GO:0031953   GO:0034198   GO:0005844   GO:0003779   GO:0043022   GO:0006446   GO:0016874   GO:0016021   GO:0000139   GO:0005515   GO:0005576   GO:0007275   GO:0016055   GO:0009166   GO:0005839   GO:0051603   GO:0046835   GO:0006281   GO:0006259  

PANTHER

PTHR16301   PTHR11884  

Subcellular location

Cytoplasm  

Length:

264

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.00156

Exp number, first 60 AAs:

0

Total prob of N-in:

0.06597

outside

1  -  264

 

 

Pi

270.161143

Theta

168.673411

Tajima's D

1.561494

CLR

0

CSRT

0.798610069496525

Interpretation

Uncertain