SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16263
Annotation
hypothetical_protein_RF55_15411_[Lasius_niger]
Location in the cell
Nuclear   Reliability : 3.728
 

Sequence

CDS
ATGTTATCGTGTTTTTTTTCAGGATTTTTCCAATTTAATGAGCAACGTGTCAGGCAACTTGTCAGTGATGTTGAGTTGGGTGACCGCCGTCCTTCGCAGTTTTTACGTTATCTTAGATCATTGGCAGGAAAAACCCTCACTGATGAAAATTTGCTTCGCCAGCTATGGATGCGTCGCCTCCCACAACATCTCCAAGCAATTTTGGCCGCCCAATCAGAACTCTCGCTGGACAAAGTCGCTGAGCTAGCGGACAAAATTTTGGAAGTTTCGCCTGGTATGGTCGCACCTCATTCATCTGCTGTTTTCTCAGCAAGTACGTCTGCCGTCTCAACCCCTTCGTTAGAAGATATCACACGGCGTCTGGATGAGGTCACGCGTCAGCTTGCTGTGCTTACTGCAGAGCGCGGTAGAAATAGGACCCGGGATTTCTCAAACCAGCGACGACGCTCACAAACGCCTGGTAAGCTTCAAATGTGCTTTTACCATAGGAAATTTAATACTAAAGCTGTTAAGTGTATTCAACCATGTACCTGGACGCCGCCGCCATCTTCGGAAAACGACAAAAGCAGTCAATGA
Protein
MLSCFFSGFFQFNEQRVRQLVSDVELGDRRPSQFLRYLRSLAGKTLTDENLLRQLWMRRLPQHLQAILAAQSELSLDKVAELADKILEVSPGMVAPHSSAVFSASTSAVSTPSLEDITRRLDEVTRQLAVLTAERGRNRTRDFSNQRRRSQTPGKLQMCFYHRKFNTKAVKCIQPCTWTPPPSSENDKSSQ

Summary

EMBL
GDQN01010239    JAT80815.1    LBMM01013103    KMQ85816.1    LBMM01012479    KMQ86203.1    + More
KL367519    KFD66949.1    KQ979048    KYN23218.1    KQ981018    KYN10257.1    LBMM01012075    KMQ86422.1    KQ980726    KYN14011.1    ACPB03037918    KQ980247    KYN17109.1    LHQN01021927    LHQN01025379    KOC58628.1    KOC58659.1    GEZM01036621    JAV82564.1    KL363297    KFD48322.1    LBMM01012610    KMQ86112.1    KL367555    KFD64488.1    IAAA01082076    LAA14320.1    KQ434816    KZC06854.1    KK111495    EZA46390.1    KQ414987    KOC58988.1    GFAC01005832    JAT93356.1    GL444488    EFN60880.1    LBMM01009142    KMQ88358.1    LBMM01012923    LBMM01012917    KMQ85926.1    KMQ85930.1    GEZM01017686    JAV90494.1    KQ981124    KYN09337.1    LBMM01026224    KMQ82336.1    KQ434840    KZC08080.1    NWSH01000267    PCG77880.1    ACPB03012735    NEVH01020366    PNF21359.1    ODYU01011787    SOQ57731.1    KL250741    KGB36059.1    KQ415240    KOC58703.1    KQ979024    KYN24351.1    FN356212    CAX83700.1    MRZV01001127    MRZV01000236    PIK40395.1    PIK54731.1    LKEX01008659    KYN50015.1    AJIL01003693    KNE87923.1    UZAL01011781    VDP05747.1    CABG01000076    CCD60595.1    LBMM01007548    KMQ89630.1    UZAL01010187    VDP03243.1    LBMM01018089    KMQ83878.1    NEVH01000707    PNF43124.1    CABG01000023    CCD59159.1    QOIP01000006    RLU21744.1    NWSH01001575    PCG70822.1    KL252356    KGB42042.1    GFTR01003955    JAW12471.1    GEDV01006140    JAP82417.1    CABG01000346    CAZ35068.1    GBRD01013927    JAG51899.1    KQ434992    KZC13185.1    KQ981301    KYN43041.1    KQ971355    EFA07205.2    CABG01000031    CCD59329.1    HE601631    CCD83017.1    CABG01000020    CCD59058.1    HE601629    CCD80464.1    ACPB03016217    NEVH01011195    PNF31836.1    NEVH01024424    PNF17276.1    NWSH01002598    PCG67884.1    CCD81852.1    KQ973343    KXZ75568.1    JTDY01001300    KOB74269.1    HE601627    CCD79752.1    GG695519    EFA13383.1    CCD79076.1    CCD80612.1    KQ971759    EFA12902.2    CABG01000094    CCD60852.1    GBRD01008790    JAG57031.1    GEDV01008183    JAP80374.1    CH905996    KPU81830.1    CCD82772.1    KQ971745    KYB24749.1    GEDV01001795    JAP86762.1    HE601624    CCD74881.1    CCD74711.1    KL250698    KGB35593.1    HE601626    CCD78440.1    CCD75122.1    CCD81588.1    HE601625    CCD77013.1    CCD77288.1    CCD80388.1    CCD80486.1    CCD81882.1    KK107241    EZA54570.1    UZAN01060843    VDP92792.1    HE601630    CCD75315.1    CCD80887.1    CCD75326.1    CCD79184.1    CCD79457.1    LHQN01026442    KQ414593    KOC58672.1    KOC70162.1    CABG01000063    CCD60342.1    CCD80379.1    CABG01000118    CAY18932.2   
Pfam
PF00665   rve        + More
PF00078   RVT_1
PF17919   RT_RNaseH_2
PF17921   Integrase_H2C2
PF17917   RT_RNaseH
PF10551   MULE
Interpro
IPR021109   Peptidase_aspartic_dom_sf        + More
IPR001969   Aspartic_peptidase_AS       
IPR001995   Peptidase_A2_cat       
IPR000477   RT_dom       
IPR041588   Integrase_H2C2       
IPR036397   RNaseH_sf       
IPR012337   RNaseH-like_sf       
IPR001584   Integrase_cat-core       
IPR041577   RT_RNaseH_2       
IPR041373   RT_RNaseH       
IPR018289   MULE_transposase_dom       
SUPFAM
SSF50630   SSF50630        + More
SSF53098   SSF53098       
Gene 3D

Ontologies

Topology

Length:
191
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00081
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00543
outside
1  -  191
 
 

Population Genetic Test Statistics

Pi
335.302981
Theta
176.121181
Tajima's D
2.863764
CLR
0
CSRT
0.972951352432378
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号