SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16189
Pre Gene Modal
BGIBMGA013926
Annotation
PREDICTED:_facilitated_trehalose_transporter_Tret1-like_[Bombyx_mori]
Location in the cell
PlasmaMembrane   Reliability : 4.964
 

Sequence

CDS
ATGGGACAATGCGGAGGCGTACCCTTACCGGGGAAAAACGTCCGTAACATCCTGGCGGCTCTTGCTGTGTCCCTTGGGCCGTTCGCAGCGGGTCTCAGTAAAGGCTACATGTCCCCAGCATTGGCGTCGATGCAGGATACAAGGATACACGATGCCTTCTCGGTTAGCGACCAACAAGCGAGTTGGATAGCTAGCCTTAGTTTATTAGGAGCCTTTATCGGTGGCATTATGGGCGGGATGGTGATGCGGTTTGGCAGAAGGACGGTGTTGCTAGCTACCGCCCTACCCTACACACTGGCGTGGCTGGCCACGGCGCTATCAAGCAGCGTGCACATGGTATCAGCCACCTCGTTCTTCGGGGGAATGCTGATCTGCTGTATAAATATGACGACACAGGTATACGTCACAGAAATAGCAGTTCCCGAGATCAGAGGATGCCTCAGCTCCGTATTGAAGATCCTCAGTCAGATCGGCATCCTAATATCATTCACTTTGGGAGCGTACCTCAACTGGTACCAACTCGCTCTGATGGTAGCCGCCGCCCCGATACTCTTATTCTTTGCTCTCTTCTTCATACCAGAAACTCCTTCTTCATTGCTCCTGAGAGGAAGGGAAACTGAAGCTGAGGATAGTCTGCAGTGGCTCAGGGGACCAGACGCGGACGTACGCCAAGAACTAGCCACAATCAGGACCAACATATTAGCCAGTAAACTGTCAAATGGGACGAACACGGGCAAATTCAAGGTATTGCTCTCGAAGCGGCTGACCAGACCAGTACTCATCACGTGCGGCCTAATGTTCTTCCAGAGATTCACTGGAGCAAACCTATTCAATTTCTACGCAGTCAAAATATTCAAGAAGACCCTAAGATCTATGAACCCTCATGGAGGGGCAATAGCGACTAGCGTTGCGCAGCTGTTGGCTTCTTGTTTGTCGGGGATGCTGATCGACAACATAGGAAGACTACCGCTTCTCATGATAAGCGGGGTGATGATGTCCATAGCCTTAGCCGGCTTCGGTTCTTACGCTTACTACGAAGAAGTTATAAGAAATACGACCGATTTAACAAGCGCCGAACCAGGATCATACGACTGGATCCCCTTGCTCTGTGTCCTGACGTTTACCATAGCCTTTTCGTTAGGCATCAGTCCGATTTCGTCTCTATTGATTGGGGAGCTGTTCCCTCTGGAGTACAGGAGTACTGGTAGCGCATTAGCGACGAGTTTCAGTCATTTGTGCGGATTCGTGAATGTTAAAACCGCCGCAGACTTCCAAGATCAAATAGGGCTCTACGGTCTGTTCTGGATGTACGCAGGTATCTCGGTCCTCTGTCTGCTGTTCGTGGTGCTATTCGTTCCGGAAACGAAGGGCCGCGAAATAGACGAGATGGACCCGAAATACGTAGAATCTTTGTGCATAAATCGATAA
Protein
MGQCGGVPLPGKNVRNILAALAVSLGPFAAGLSKGYMSPALASMQDTRIHDAFSVSDQQASWIASLSLLGAFIGGIMGGMVMRFGRRTVLLATALPYTLAWLATALSSSVHMVSATSFFGGMLICCINMTTQVYVTEIAVPEIRGCLSSVLKILSQIGILISFTLGAYLNWYQLALMVAAAPILLFFALFFIPETPSSLLLRGRETEAEDSLQWLRGPDADVRQELATIRTNILASKLSNGTNTGKFKVLLSKRLTRPVLITCGLMFFQRFTGANLFNFYAVKIFKKTLRSMNPHGGAIATSVAQLLASCLSGMLIDNIGRLPLLMISGVMMSIALAGFGSYAYYEEVIRNTTDLTSAEPGSYDWIPLLCVLTFTIAFSLGISPISSLLIGELFPLEYRSTGSALATSFSHLCGFVNVKTAADFQDQIGLYGLFWMYAGISVLCLLFVVLFVPETKGREIDEMDPKYVESLCINR

Summary

Similarity
Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family.
EMBL
BABH01018390    KQ459630    KPJ20529.1    ODYU01001498    SOQ37791.1    NWSH01001318    + More
PCG71727.1    AGBW02010477    OWR48436.1    KQ459583    KPI98609.1    KZ150284    PZC71619.1    KK852471    KDR23173.1    ODYU01012334    SOQ58592.1    AGBW02012232    OWR45394.1    PCG71726.1    PZC71620.1    KPJ20528.1    KPI98608.1    JTDY01004693    KOB67868.1    GEDC01013448    GEDC01009429    JAS23850.1    JAS27869.1    NEVH01016358    PNF25221.1    PYGN01000324    PSN48516.1    CH477390    EAT41976.1    CVRI01000038    CRK93847.1    GDUN01000912    JAN95007.1    AAAB01008984    EAA15072.4    ACPB03017604    AB901066    BAQ02366.1    KQ414667    KOC64832.1    AJWK01009124    GL447257    EFN86631.1    KQ980581    KYN15288.1    ADMH02001962    ETN60224.1    KQ982373    KYQ56988.1    KQ434809    KZC06729.1    KQ976500    KYM83206.1    ADTU01011283    KQ435697    KOX80765.1    BABH01018387    APCN01004224    KQ981673    KYN38343.1    GL434492    EFN74848.1    KK854126    PTY11753.1    AXCM01000161    AXCN02000773    DS235430    EEB15716.1    AJVK01005422    LBMM01000140    KMR04783.1    QOIP01000004    RLU23501.1    KQ977059    KYN06045.1    ATLV01017584    KE525174    KFB42307.1    KZ288229    PBC31677.1    GL888932    EGI57211.1    KK107372    EZA51700.1    GECU01034016    JAS73690.1    GDIQ01239995    JAK11730.1    GDIP01237473    GDIP01204568    GDIP01121437    GDIP01093679    GDIP01083749    GDIP01079601    LRGB01000311    JAI85928.1    KZS19803.1    GDIQ01241535    JAK10190.1    GDIQ01053004    JAN41733.1    LNIX01000003    OXA58357.1    GDIQ01225036    JAK26689.1    GL732601    EFX72237.1    LJIJ01000174    ODN01053.1    HACA01023814    CDW41175.1    KQ784025    OAD51877.1    APGK01045776    KB741039    ENN74518.1    GDIQ01014409    JAN80328.1    KB632367    ERL93666.1    GDIP01222290    JAJ01112.1    GDRN01105627    JAI57703.1    KQ971354    KYB26540.1    OXA57021.1    NNAY01001300    OXU24432.1    GFDF01009470    JAV04614.1    GDIQ01202583    JAK49142.1    IACF01000422    LAB66198.1    KQ775154    OAD52283.1    GAMC01019093    GAMC01019092    JAB87463.1    KQ434977    KZC12919.1    KZ288203    PBC33461.1    JR039436    AEY58702.1    AAZX01001793    AJWK01000224    AJWK01000225    KQ977041    KYN06178.1   
Pfam
PF00083   Sugar_tr        + More
PF07690   MFS_1
PF01569   PAP2
PF10147   CR6_interact
Interpro
IPR036259   MFS_trans_sf        + More
IPR020846   MFS_dom       
IPR005828   MFS_sugar_transport-like       
IPR003663   Sugar/inositol_transpt       
IPR011701   MFS       
IPR000326   P_Acid_Pase_2/haloperoxidase       
IPR036938   P_Acid_Pase_2/haloperoxi_sf       
IPR018472   Damage-induce-interacting_prot       
IPR005829   Sugar_transporter_CS       
SUPFAM
SSF103473   SSF103473        + More
SSF48317   SSF48317       
PDB
6H7D     E-value=6.96972e-23,     Score=266

Ontologies

Topology

Length:
475
Number of predicted TMHs:
10
Exp number of AAs in TMHs:
219.33534
Exp number, first 60 AAs:
19.91254
Total prob of N-in:
0.87674
POSSIBLE N-term signal
sequence
inside
1  -  12
TMhelix
13  -  32
outside
33  -  59
TMhelix
60  -  82
inside
83  -  88
TMhelix
89  -  108
outside
109  -  117
TMhelix
118  -  140
inside
141  -  146
TMhelix
147  -  169
outside
170  -  172
TMhelix
173  -  192
inside
193  -  259
TMhelix
260  -  282
outside
283  -  321
TMhelix
322  -  344
inside
345  -  364
TMhelix
365  -  387
outside
388  -  430
TMhelix
431  -  453
inside
454  -  475
 
 

Population Genetic Test Statistics

Pi
207.347897
Theta
149.501751
Tajima's D
1.160975
CLR
0.197465
CSRT
0.706514674266287
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号