SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16024
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.482
 

Sequence

CDS
ATGGAACGTATCAGCAACAGCCTAGGCCTCTCCATAAATAGATCAAAAACGAAATTAATGGTGGTGGATCGTGCAAATGTTCTAAAATTGAGTAGGGCGCTTGGATTAGAGGTTGTAGACGAATTCGTGTATCTCGGGTCCTGCATCAGCAACAAAGGCTCATGTGAAACTGACGTGCGCCGACGTATCGGAATGGCTAAAAGTGCGATGTCTCAGCTACAGAAGATCTGGAAGAATAGAGGGATAGGCCTGAAAACTAAAACCAGACTGGTGCAGACTCTTGTTTTCTCTATCTTCTTGTATGGAGCTGAGACATGGACGTTGAAAGCAGCAGACCGAATGCGCATCGATGCTTTCGAAATGTGGTGTTGGAGACGCATGCTAAGAATTCCGTGGACAGCCTTCCGGACTAACGTGTCGATATTGAAGCAACTGGGCATCAAAATCAGACTGTGTCTACTGTCTAGAGGCCGCAGCCATACTCGTTGGTCCGATCAGATCCGCACCGCTTTGGACAGTACAGTGTACAGCGCGCTGCATGACGCCATGGACAGGGGAAAGTGGAAAAAGATCTTAAGATTGAAGCTCATGGGTGATGGTGGTCACGACCCTCAGACATGA
Protein
MERISNSLGLSINRSKTKLMVVDRANVLKLSRALGLEVVDEFVYLGSCISNKGSCETDVRRRIGMAKSAMSQLQKIWKNRGIGLKTKTRLVQTLVFSIFLYGAETWTLKAADRMRIDAFEMWCWRRMLRIPWTAFRTNVSILKQLGIKIRLCLLSRGRSHTRWSDQIRTALDSTVYSALHDAMDRGKWKKILRLKLMGDGGHDPQT

Summary

Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR002138   Pept_C14_p10       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
206
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.38429
Exp number, first 60 AAs:
0.0016
Total prob of N-in:
0.06625
outside
1  -  206
 
 

Population Genetic Test Statistics

Pi
8.353038
Theta
18.222724
Tajima's D
-1.609034
CLR
1.842344
CSRT
0.0470976451177441
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号