SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO16008
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 1.953
 

Sequence

CDS
ATGTCCCGGAAAATGTTGCCTTCTATCAAAAAGCGCAAGATAGAATATCTCGGCCACGTGCTCAGGAACGATAGATACACGCTGTTGCAGTTGATAATGATGGGCAAAGTGGACGGAAAAAGACGTGCTGGGCGAAGAAAGAAGTCATGGCTCTGGAATATCCGGGAGGGGGCCGGTATTGACTCCGTCGAACAGCTGTTCCGGCTGGCTGCTGATACAGATGAATACAGGAAGCTAACGGCCAACCTTCAGGATTGA
Protein
MSRKMLPSIKKRKIEYLGHVLRNDRYTLLQLIMMGKVDGKRRAGRRKKSWLWNIREGAGIDSVEQLFRLAADTDEYRKLTANLQD

Summary

EMBL
GU815089    ADF18552.1    NWSH01002736    PCG67606.1    KQ460652    KPJ12975.1    + More
KQ977522    KYN02133.1    KQ459585    KPI98284.1    GBHO01041897    JAG01707.1    GDHC01017214    JAQ01415.1    GAIX01012977    JAA79583.1    KQ459602    KPI93474.1    GBRD01005612    JAG60209.1    GBHO01028834    JAG14770.1    LBMM01003995    KMQ92919.1    ODYU01000306    SOQ34818.1    KQ459765    KPJ20087.1    GGMS01008711    MBY77914.1    GGMS01004979    MBY74182.1    GGMS01000367    MBY69570.1    LBMM01001656    KMQ95932.1    GBHO01020011    GDHC01013600    JAG23593.1    JAQ05029.1    NWSH01001998    PCG69477.1    LADJ01023802    KPJ21112.1    LADJ01040095    KPJ21345.1    GGMR01005851    MBY18470.1    ABLF02012409    ABLF02012412    RQTK01001448    RUS70261.1    GGMR01013640    MBY26259.1    LBMM01006413    KMQ90631.1    AAGJ04161766    GGMR01012724    MBY25343.1    RQTK01001364    RUS70632.1    RQTK01000360    RUS81011.1    RQTK01000752    RUS75316.1    RQTK01000011    RUS91450.1    AFYH01119920    GGMR01016842    MBY29461.1    HACG01049256    CEK96121.1    BART01031562    GAH15691.1    KZ149912    PZC78062.1    HACG01049248    HACG01049253    CEK96113.1    CEK96118.1    HACG01049244    HACG01049247    CEK96109.1    CEK96112.1    HACG01049251    HACG01049252    CEK96116.1    CEK96117.1    RQTK01000685    RUS76136.1    NCKU01004395    RWS06003.1    RSAL01000289    RVE42931.1    RQTK01000625    RUS76894.1    AAGJ04021158    NWSH01000469    PCG76200.1    MRZV01000221    PIK55282.1    HACG01049496    CEK96361.1    QIAP01000240    PYX61602.1    RQTK01000357    RUS81065.1    HACG01049494    HACG01049495    CEK96359.1    CEK96360.1    KZ150087    PZC73751.1    GAIX01008594    JAA83966.1    ABLF02024992    ABLF02024994    ABLF02025002    ABLF02043975    RQTK01000220    RUS84039.1    AAGJ04075245    KQ459603    KPI92872.1    ABLF02015324    KK853131    KDR10935.1    KZ150366    PZC71172.1    ABLF02042206    MRZV01000940    PIK42365.1    ODYU01006805    SOQ48998.1    GDHC01009154    JAQ09475.1    HACG01049492    CEK96357.1    RQTK01001013    RUS72821.1    KK852870    KDR14607.1    PYGN01001438    PSN34841.1    HACG01049490    HACG01049491    CEK96355.1    CEK96356.1    PYGN01001548    PSN34137.1    KZ149985    PZC75696.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF03188   Cytochrom_B561
PF03221   HTH_Tnp_Tc5
PF04218   CENP-B_N
PF05699   Dimer_Tnp_hAT
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR006593   Cyt_b561/ferric_Rdtase_TM       
IPR036734   Neur_chan_lig-bd_sf       
IPR027124   Swc5/CFDP2       
IPR006600   HTH_CenpB_DNA-bd_dom       
IPR007889   HTH_Psq       
IPR009057   Homeobox-like_sf       
IPR008906   HATC_C_dom       
IPR000637   HMGI/Y_DNA-bd_CS       
SUPFAM
SSF56219   SSF56219        + More
SSF63712   SSF63712       
SSF46689   SSF46689       
Gene 3D

Ontologies

Topology

Length:
85
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00471
Exp number, first 60 AAs:
0.00317
Total prob of N-in:
0.34766
outside
1  -  85
 
 

Population Genetic Test Statistics

Pi
175.86097
Theta
184.81979
Tajima's D
-0.152528
CLR
0
CSRT
0.332783360831958
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号