SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15939
Annotation
PREDICTED:_uncharacterized_protein_LOC101735858_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.823
 

Sequence

CDS
ATGGGTGATTTCAACACCGACCTTGCAGTTCATTCACCTCGATCCTGTAAACTCTTGGCTATCGTCGAATCTGCTAATCTTCAAGTCCTGCCTCTACAAGCCACTCATTGGAACAGTGATGGGAATGACACCTGGCTTGATCTAATTCTTACTTCCTCTCCCACCCTTGTATCATCTCATGGTCAATATCCCGCACCTGGCTTCTCTCATCATGACCTCATTTTCCTCTCTTACTCCTTAAGTCCTCCGAAGTCCCAACCTAGGCTTATGAGCATACGTAGTTTCAAACGCTTAAATTTAGATCAGTTGCAAAAGGATGCGTCAGAATTAAAATGGGATGATTTCATGGCTACACCTTCTGTAGATGATAAAGTGCGTATTTTTAATGAAACTATCCTTAACTTGTATGATATCCATGCGCCTGTTAGGAAGGTGAAGATGAAGCGTCCTCCAGCTCCATGGATAACGAGAGGTGTGCGTATGTGTATGCGGCGTAGAGATAGAGCTTTTCGTAAATTCCGGAGGGACCGATGCGATGACAATTGGGCTTCTTATAAAATTGCGAGAAACCGGTAAAGAAGAGATTATTAA
Protein
MGDFNTDLAVHSPRSCKLLAIVESANLQVLPLQATHWNSDGNDTWLDLILTSSPTLVSSHGQYPAPGFSHHDLIFLSYSLSPPKSQPRLMSIRSFKRLNLDQLQKDASELKWDDFMATPSVDDKVRIFNETILNLYDIHAPVRKVKMKRPPAPWITRGVRMCMRRRDRAFRKFRRDRCDDNWASYKIARNRXRRDY

Summary

Similarity
Belongs to the type-B carboxylesterase/lipase family.
EMBL
KZ149919    PZC77785.1    NWSH01000281    PCG77798.1    AB126233    BAD86664.1    + More
RSAL01001827    RVE40669.1    RSAL01000685    RVE41235.1    RSAL01000069    RVE49233.1    RSAL01000258    RVE43396.1    NWSH01000817    PCG74070.1    JTDY01001352    KOB74103.1    NWSH01000893    PCG73654.1    JTDY01003407    KOB69609.1    GEBQ01020572    JAT19405.1    RSAL01001570    RVE40758.1    RSAL01000177    RVE45007.1    GEBQ01019069    JAT20908.1    GEBQ01030598    JAT09379.1    ODYU01005692    SOQ46802.1    GBHO01012041    GBHO01012038    JAG31563.1    JAG31566.1    GECU01032745    JAS74961.1    GEBQ01012923    JAT27054.1    QOIP01000003    RLU25058.1    LBMM01014048    KMQ85356.1    GEBQ01011636    JAT28341.1    LBMM01006362    KMQ90665.1    GBHO01000549    JAG43055.1    DNUT01000248    HBI40236.1    DMQF01000352    HAO15199.1    LBMM01011026    KMQ87076.1    LBMM01015471    KMQ84794.1    DNUT01000507    HBI41157.1    LBMM01015415    KMQ84818.1    GANO01004094    JAB55777.1    LBMM01010997    KMQ87090.1    QOIP01000005    RLU22413.1    JTDY01001347    KOB74123.1    LBMM01017550    KMQ84053.1    GEHC01000896    JAV46749.1    AAZX01004211    AAZX01006722    AAZX01008950    AAZX01010809    AAZX01011112    AAZX01013477    AAZX01017075    AAZX01021458    AAZX01024834    AAZX01026568    AAZX01026045    AAZX01026373    GEZM01074146    JAV64657.1    GEZM01074147    JAV64656.1    GANO01004066    JAB55805.1    GEZM01000581    JAV98361.1    CVRI01000015    CRK89922.1    QOIP01000004    RLU23301.1    NNAY01006284    OXU16417.1    GANO01004238    JAB55633.1    AAZX01005043    NWSH01000998    PCG73165.1    NWSH01002492    PCG68177.1    AAZX01023263    AAZX01023987    RCHS01001730    RMX51643.1    ODYU01008503    SOQ52166.1    GEHC01001143    JAV46502.1    LSMT01000669    PFX15237.1    GANO01004361    JAB55510.1    GEZM01051381    GEZM01051380    JAV74995.1    LSMT01000554    PFX16333.1    GANO01004275    JAB55596.1    LBMM01017805    KMQ83966.1    KQ978682    KYN29318.1    AAZX01005367    DNUT01000056    HBI39512.1    NWSH01000774    PCG74303.1    AAGJ04020328    AAZX01010122    AAZX01026204    GEZM01041318    GEZM01041317    JAV80524.1    GBBI01004799    JAC13913.1    GANO01001936    JAB57935.1    DMQF01000030    HAO14052.1    AAZX01004066    AAZX01006184    AAZX01006409    AAZX01014295    GEGO01005774    JAR89630.1    LSMT01000071    PFX29084.1    NWSH01000010    PCG80923.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00135   COesterase
PF00078   RVT_1
PF06441   EHN
PF03372   Exo_endo_phos
PF01997   Translin
PF08205   C2-set_2
PF02668   TauD
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR002018   CarbesteraseB       
IPR019826   Carboxylesterase_B_AS       
IPR029058   AB_hydrolase       
IPR000477   RT_dom       
IPR000639   Epox_hydrolase-like       
IPR010497   Epoxide_hydro_N       
IPR016069   Translin_C       
IPR007110   Ig-like_dom       
IPR003599   Ig_sub       
IPR013783   Ig-like_fold       
IPR013162   CD80_C2-set       
IPR003598   Ig_sub2       
IPR016068   Translin_N       
IPR036179   Ig-like_dom_sf       
IPR036081   Translin_sf       
IPR002848   Translin_fam       
IPR003819   TauD/TfdA-like       
IPR042098   TauD-like_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF53474   SSF53474       
SSF48726   SSF48726       
SSF74784   SSF74784       

Ontologies

Topology

Length:
196
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00392
Exp number, first 60 AAs:
0.00156
Total prob of N-in:
0.12540
outside
1  -  196
 
 

Population Genetic Test Statistics

Pi
27.42506
Theta
50.495886
Tajima's D
-1.29284
CLR
52.199489
CSRT
0.0905454727263637
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号