SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15895
Annotation
PREDICTED:_dual_serine/threonine_and_tyrosine_protein_kinase-like_[Bombyx_mori]
Full name
Dual serine/threonine and tyrosine protein kinase      
Alternative Name
Dusty protein kinase
Receptor-interacting serine/threonine-protein kinase 5
Location in the cell
Cytoplasmic   Reliability : 2.771
 

Sequence

CDS
ATGAGGATCAGCTGCGATATCGTCGACGGCATCCGCTACCTGCACTCGCTGGGTCTGGTGCACCGCGACATCAAGACGAAGAACGTCCTCCTGGACGGGGCGGACCGCGCGGCGCTGTCGGACCTCGGCTTCTGCACGGCCGGCGCGCTCATGTCGGGCTCCGTGGTGGGCACGCCGGTGCACATGGCGCCCGAGCTGCTGGCCGGGGACTACCACGCCTCCGTCGACGTGTACGCTTTCGGGATCTTGTTCTGGTACGTGTGCGCTGGTGACATAAAGCTACCGTCAGCTTTCGAAACTTTCCAAAACAAGGAACAGCTTTGGAGTAAGGTTAAAAGAGGTCTGAGACCTGAACGTCTACCTCAGTTCTCGGACGAGTGCTGGGAGATCATGGAGTCGTGCTGGGCCTCCGAGCCCTCCCAGCGGGCGCTCCTCGGGGACGTGCAGAACAAGCTGGAGAGGATCTTGGAGCAGGCTCTAAAGGACGAAAAGTCTCCTGGCTACCTCGCCCCGGACGAGCCAGACCTTAACGACGACTAG
Protein
MRISCDIVDGIRYLHSLGLVHRDIKTKNVLLDGADRAALSDLGFCTAGALMSGSVVGTPVHMAPELLAGDYHASVDVYAFGILFWYVCAGDIKLPSAFETFQNKEQLWSKVKRGLRPERLPQFSDECWEIMESCWASEPSQRALLGDVQNKLERILEQALKDEKSPGYLAPDEPDLNDD

Summary

Description
Acts as a positive regulator of ERK phosphorylation downstream of fibroblast growth factor-receptor activation. Involved in the regulation of both caspase-dependent apoptosis and caspase-independent cell death. In the skin, it plays a predominant role in suppressing caspase-dependent apoptosis in response to UV stress in a range of dermal cell types.
May act as a positive regulator of ERK phosphorylation downstream of fibroblast growth factor-receptor activation. May induce both caspase-dependent apoptosis and caspase-independent cell death (By similarity). Plays a role in the embryonic development.
Catalytic Activity
ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein]
ATP + L-threonyl-[protein] = ADP + H(+) + O-phospho-L-threonyl-[protein]
Similarity
Belongs to the protein kinase superfamily.
Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
Keywords
ATP-binding   Cell junction   Cell membrane   Coiled coil   Complete proteome   Cytoplasm   Kinase   Membrane   Nucleotide-binding   Reference proteome   Transferase   Tyrosine-protein kinase   Alternative splicing   Developmental protein  
Feature
chain  Dual serine/threonine and tyrosine protein kinase
splice variant  In isoform 2.
EC Number
2.7.12.1
EMBL
KQ459597    KPI95254.1    KQ460466    KPJ14600.1    KZ150391    PZC71049.1    + More
ODYU01007222    SOQ49810.1    NWSH01000148    PCG79059.1    AGBW02008451    OWR53333.1    LJIG01022577    KRT79835.1    KQ414646    KOC66405.1    APGK01047273    KB741077    KB632432    ENN74312.1    ERL95551.1    KQ971307    KYB29627.1    KQ982173    KYQ59380.1    KQ976933    KYN07003.1    KK107609    QOIP01000014    EZA48519.1    RLU15104.1    KQ976547    KYM80927.1    GL732530    EFX86277.1    KQ981744    KYN36439.1    GL435543    EFN73209.1    ADTU01012291    GL888498    EGI59957.1    AAGJ04000566    GL451914    EFN78262.1    GFPF01007398    MAA18544.1    GFPF01007400    MAA18546.1    ABJB010666035    ABJB010750526    DS651463    EEC02517.1    GACK01009280    JAA55754.1    GBGP01000278    JAC84917.1    NNAY01000604    OXU27421.1    GFPF01007399    MAA18545.1    GDIQ01068396    JAN26341.1    GEFH01000756    JAP67825.1    GEDV01012599    JAP75958.1    GBYB01013562    JAG83329.1    GBYB01012356    GBYB01013563    JAG82123.1    JAG83330.1    GEDV01006107    JAP82450.1    CAEY01000486    LZPO01037266    OBS75401.1    GDIQ01201949    JAK49776.1    QRBI01000149    RMB99252.1    KQ435896    KOX69266.1    GFAC01005368    JAT93820.1    ABQF01074534    LBMM01001760    KMQ95799.1    NCKU01000345    RWS15880.1    GFAA01001450    JAU01985.1    GBBM01003531    JAC31887.1    FR904557    CDQ66806.1    GFWV01009038    MAA33767.1    GDIQ01033662    JAN61075.1    QCYY01004352    ROT61111.1    GDIQ01170615    JAK81110.1    GDIP01139823    JAL63891.1    GDIP01121422    JAL82292.1    GDIP01125789    JAL77925.1    GDIP01140579    JAL63135.1    GDIQ01183010    JAK68715.1    GDIP01058741    JAM44974.1    GDIP01030694    JAM73021.1    GDIP01064948    JAM38767.1    GDIQ01008359    JAN86378.1    GDIQ01117866    JAL33860.1    GDIP01133027    JAL70687.1    KZ288287    PBC29366.1    GFWV01009039    MAA33768.1    AGCU01153103    AGCU01153104    AGCU01153105    AGCU01153106    AGCU01153107    AGCU01153108    AGCU01153109    AGCU01153110    AGCU01153111    AGCU01153112    LNIX01000017    OXA45764.1    AAEX03018251    AAEX03018252    IACK01003771    LAA68647.1    AEMK02000070    GEZM01095810    JAV55331.1    GEZM01095811    JAV55330.1    RJVU01042601    ROL45207.1    GFJQ02007945    JAV99024.1    KL536230    KFO94515.1    KK852812    KDR15870.1    MKHE01000014    OWK08202.1    GGLE01005050    MBY09176.1    LRGB01000996    KZS14223.1    RAZU01000200    RLQ66289.1    AY641093    KK376193    KFV46062.1    AY208855    AY429681    AY641096    BC067573    BC118677    PPHD01009339    POI31198.1    KK546586    KFP32526.1    GANP01009925    JAB74543.1    GEFM01006636    JAP69160.1    KL385747    KFP89854.1    KB548129    EMP30840.1   
Pfam
PF00069   Pkinase        + More
PF07714   Pkinase_Tyr
PF00400   WD40
Interpro
IPR008271   Ser/Thr_kinase_AS        + More
IPR011009   Kinase-like_dom_sf       
IPR000719   Prot_kinase_dom       
IPR017441   Protein_kinase_ATP_BS       
IPR001245   Ser-Thr/Tyr_kinase_cat_dom       
IPR007110   Ig-like_dom       
IPR017986   WD40_repeat_dom       
IPR001680   WD40_repeat       
IPR036179   Ig-like_dom_sf       
IPR015943   WD40/YVTN_repeat-like_dom_sf       
SUPFAM
SSF56112   SSF56112        + More
SSF48726   SSF48726       
Gene 3D
PDB
5O26     E-value=1.57968e-15,     Score=197

Ontologies

Topology

Subcellular location
Cytoplasm   Detected in basolateral and apical membranes of all tubular epithelia. Detected at apical cell-cell junctions. Colocalized with FGF receptors to the cell membrane.   With evidence from 1 publications.
Cell membrane   Detected in basolateral and apical membranes of all tubular epithelia. Detected at apical cell-cell junctions. Colocalized with FGF receptors to the cell membrane.   With evidence from 1 publications.
Apical cell membrane   Detected in basolateral and apical membranes of all tubular epithelia. Detected at apical cell-cell junctions. Colocalized with FGF receptors to the cell membrane.   With evidence from 1 publications.
Basolateral cell membrane   Detected in basolateral and apical membranes of all tubular epithelia. Detected at apical cell-cell junctions. Colocalized with FGF receptors to the cell membrane.   With evidence from 1 publications.
Cell junction   Detected in basolateral and apical membranes of all tubular epithelia. Detected at apical cell-cell junctions. Colocalized with FGF receptors to the cell membrane.   With evidence from 1 publications.
Length:
179
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
4.48827
Exp number, first 60 AAs:
1.92463
Total prob of N-in:
0.22300
outside
1  -  179
 
 

Population Genetic Test Statistics

Pi
43.857266
Theta
43.011215
Tajima's D
-0.431621
CLR
0.000008
CSRT
0.260886955652217
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号