SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15894
Annotation
PREDICTED:_dual_serine/threonine_and_tyrosine_protein_kinase-like_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.103
 

Sequence

CDS
ATGCTGATGCACGGCGTTCCGGAGCTGGGCAGGGAGATCGGTCGCGGGCAGTACGGCGTGGTTTACGCCGTCCGCGGCAGCTGGGGGGGCCACTCGCCGGTCGCGGTCAAGTCGGTGCTGCCCACGGACGAGCGCATTACCACGAGCTGGCCATGGAATTCTTTTATACTAGGTGCTGTCATTTTCATGATTTACTTACAGCGGCGTTACGAATTGCTGACGGATTCTCTACCAGTCGAGGGTGCTGTATAG
Protein
MLMHGVPELGREIGRGQYGVVYAVRGSWGGHSPVAVKSVLPTDERITTSWPWNSFILGAVIFMIYLQRRYELLTDSLPVEGAV

Summary

Uniprot
ProteinModelPortal

Ontologies

Topology

Length:
83
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
14.74529
Exp number, first 60 AAs:
10.20848
Total prob of N-in:
0.07345
POSSIBLE N-term signal
sequence
outside
1  -  83
 
 

Population Genetic Test Statistics

Pi
51.262352
Theta
116.275012
Tajima's D
-0.47404
CLR
107.23364
CSRT
0.24298785060747
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号