SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15883
Pre Gene Modal
BGIBMGA013373
Annotation
PREDICTED:_talin-1-like_[Papilio_machaon]
Location in the cell
Cytoplasmic   Reliability : 1.009 Nuclear   Reliability : 1.074
 

Sequence

CDS
ATGAAAGGTAAAAAGAAGTTGATACCACGTCTCCTGGGCATCAACGCTGAATCCATTCTGCGCCTAGACGAGACTACGAAAGAAATCCTGCAAGTTTGGCCCTTGACTCACGTGAAGACCTATAACGTTGCCAACGCCGAGGCTTTTATTCTGAACTTCGGCGAATACAGTGAGGAACCGTACACCGTGAAGACCAGAGACGCCAACCAGATCAGAGATATTCTGGAGGGCTACATCGATCTGATAGGGAAGAAGCTTCTGGCCAAGCATAACTTCAGCAGCTCCGATAGGATGATCATAACCGAAGATGAAGTAGCTCCTTCTAAGTGA
Protein
MKGKKKLIPRLLGINAESILRLDETTKEILQVWPLTHVKTYNVANAEAFILNFGEYSEEPYTVKTRDANQIRDILEGYIDLIGKKLLAKHNFSSSDRMIITEDEVAPSK

Summary

EMBL
BABH01037490    KQ460466    KPJ14605.1    KQ459597    KPI95249.1    ODYU01007842    + More
SOQ50970.1    NWSH01000974    PCG73326.1    KZ150183    PZC72483.1    GALX01003213    JAB65253.1    KB632095    ERL88738.1    MRZV01001323    PIK38708.1    APGK01025933    APGK01025934    APGK01025935    KB740605    ENN80059.1    NWSH01001427    PCG71271.1    ODYU01002006    SOQ38968.1    GL771866    EFZ09348.1    BABH01038074    BABH01038075    BABH01038076    KQ459593    KPI96374.1    KQ460152    KPJ17352.1    AGBW02009276    OWR51195.1    GEZM01051361    JAV75008.1    GEZM01051359    GEZM01051357    JAV75016.1    ABJB010002632    ABJB010062123    ABJB010379358    ABJB010428970    ABJB010506374    ABJB010562744    ABJB010575441    ABJB010633491    ABJB010781916    ABJB010798695    DS969850    EEC19958.1    LBMM01008317    KMQ88985.1    GEZM01051360    GEZM01051358    JAV75010.1    ABLF02040907    GBBM01000771    JAC34647.1    GBYX01437347    JAO44002.1    GECU01007852    JAS99854.1    RSAL01000058    RVE49730.1    GEFM01003222    JAP72574.1    GANP01006827    JAB77641.1    LJIG01016230    KRT81224.1    GGMR01006837    MBY19456.1    GEBQ01016146    JAT23831.1    AZIM01000142    ETE73062.1    GGMS01005153    MBY74356.1    GFXV01002245    MBW14050.1    HAED01015993    SBR02438.1    AGBW02012523    OWR44939.1    GBYX01231939    JAO67741.1    ABLF02024901    JXUM01043900    KQ561380    KXJ78773.1    JTDY01001911    KOB72561.1    GAPW01000510    JAC13088.1    GBYX01231948    JAO67736.1    GEDC01019901    GEDC01009902    GEDC01003946    JAS17397.1    JAS27396.1    JAS33352.1    GEDC01031369    GEDC01020851    GEDC01015209    JAS05929.1    JAS16447.1    JAS22089.1    CH477380    EAT42216.1    GGMS01012351    MBY81554.1    GDUN01000922    JAN94997.1    KQ971351    KYB26811.1    JXUM01082049    JXUM01082050    JXUM01082051    KQ563286    KXJ74128.1    GGMS01013026    MBY82229.1    AXCN02000381    KQ435782    KOX74764.1    AK165499    BAE38220.1    GGLE01001409    MBY05535.1    GFAC01001233    JAT97955.1    KQ435087    KZC14531.1    GEDV01011536    JAP77021.1    GAPW01000419    JAC13179.1    GBYX01437348    JAO44001.1    APCN01000204    AAAB01008807    EAA04618.3    GEFH01003634    JAP64947.1    GEDV01008164    JAP80393.1    GFPF01012237    MAA23383.1    GACK01001466    JAA63568.1    HAAF01005796    CCP77620.1    GACK01001711    JAA63323.1    KB016982    EPY81739.1    GDIP01048428    JAM55287.1    GDIQ01084023    JAN10714.1    GDIP01097621    JAM06094.1    GDIP01185359    JAJ38043.1    GECZ01003643    JAS66126.1    GDIP01132768    JAL70946.1    GDIP01198759    JAJ24643.1    GDIP01153021    JAJ70381.1    GDIP01037183    JAM66532.1    KB550683    EMP30300.1    KQ983089    KYQ47547.1    AFYH01009561    AFYH01009562    AFYH01009563    AFYH01009564    AFYH01009565    AFYH01009566    AFYH01009567    AFYH01009568    AFYH01009569    AFYH01009570    GDIP01198758    JAJ24644.1    AAWZ02035976    GDIP01174310    JAJ49092.1    GDIP01196860    JAJ26542.1    KZ288358    PBC27080.1   
Pfam
PF00373   FERM_M        + More
PF09379   FERM_N
PF16511   FERM_f0
PF09141   Talin_middle
PF01044   Vinculin
PF10545   MADF_DNA_bdg
PF02174   IRS
PF01608   I_LWEQ
PF08913   VBS
PF00067   p450
Interpro
IPR019748   FERM_central        + More
IPR011993   PH-like_dom_sf       
IPR000299   FERM_domain       
IPR014352   FERM/acyl-CoA-bd_prot_sf       
IPR035963   FERM_2       
IPR032425   FERM_f0       
IPR019749   Band_41_domain       
IPR018979   FERM_N       
IPR036723   Alpha-catenin/vinculin-like_sf       
IPR036476   Talin_cent_sf       
IPR015224   Talin_cent       
IPR035964   I/LWEQ_dom_sf       
IPR006077   Vinculin/catenin       
IPR004210   BESS_motif       
IPR006578   MADF-dom       
IPR029071   Ubiquitin-like_domsf       
IPR030224   Sla2_fam       
IPR019747   FERM_CS       
IPR002558   ILWEQ_dom       
IPR002404   IRS_PTB       
IPR015009   Vinculin-bd_dom       
IPR037438   Talin1/2-RS       
IPR036396   Cyt_P450_sf       
IPR001128   Cyt_P450       
IPR017972   Cyt_P450_CS       
IPR002401   Cyt_P450_E_grp-I       
IPR008069   Cyt_P450_E_grp-I_CYP2D-like       
SUPFAM
SSF47031   SSF47031        + More
SSF47220   SSF47220       
SSF109885   SSF109885       
SSF109880   SSF109880       
SSF54236   SSF54236       
SSF48264   SSF48264       
Gene 3D
PDB
3G9W     E-value=4.14303e-21,     Score=243

Ontologies

Topology

Subcellular location
Nucleus  
Length:
109
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00204
Exp number, first 60 AAs:
0.00204
Total prob of N-in:
0.44942
outside
1  -  109
 
 

Population Genetic Test Statistics

Pi
336.257104
Theta
175.51074
Tajima's D
2.888496
CLR
0.030206
CSRT
0.974051297435128
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号