SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15880
Pre Gene Modal
BGIBMGA013370
Annotation
PREDICTED:_talin-2-like_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.905
 

Sequence

CDS
ATGGAAGACGAGAAAGTCGAGAATAAGCCACGGTCTACCGGGACGCTGACTGCGAAGACACTTCAGTCTGGTCGCGACGCGCAGTTTGAGGAACTCAGCAAGAAGCTCCACACTGATGATAATGTCAAATGGCTCGACCACCACAAGACGCTTCGGGAGCTGTCCTTGGACGAGACCACGCCGTTCCTGCTGAAGAGGAAACTCTTCTACTCTGACAAGAACGTGGACGAAAGAGACCCGATGCAGCTCAATCTTCTCTACTTGCAAACCAGAGATGCAATACTCAACTTGACTCATCCGGTCACCGAAAAAGAAGGTGAGTTTTAA
Protein
MEDEKVENKPRSTGTLTAKTLQSGRDAQFEELSKKLHTDDNVKWLDHHKTLRELSLDETTPFLLKRKLFYSDKNVDERDPMQLNLLYLQTRDAILNLTHPVTEKEGEF

Summary

EMBL
BABH01037489    GDQN01004547    JAT86507.1    KZ150183    PZC72480.1    ODYU01001771    + More
SOQ38436.1    GECZ01003328    JAS66441.1    ABJB010002632    ABJB010062123    ABJB010379358    ABJB010428970    ABJB010506374    ABJB010562744    ABJB010575441    ABJB010633491    ABJB010781916    ABJB010798695    DS969850    EEC19958.1    GECU01007852    JAS99854.1    KQ459597    KPI95249.1    GALX01003213    JAB65253.1    GEFM01003222    JAP72574.1    GANP01006827    JAB77641.1    KQ460466    KPJ14605.1    GEBQ01016146    JAT23831.1    NWSH01000974    PCG73339.1    GECZ01030847    JAS38922.1    GFAC01001233    JAT97955.1    GEDV01008164    JAP80393.1    GFPF01012237    MAA23383.1    GACK01001711    JAA63323.1    GACK01001466    JAA63568.1    GL771866    EFZ09348.1    GEDV01011536    JAP77021.1    GEFH01003634    JAP64947.1    GBBM01000771    JAC34647.1    GBYX01192628    GBYX01192624    GBYX01192623    GBYX01192620    JAO82251.1    NEVH01002981    PNF41181.1    GEDC01019901    GEDC01009902    GEDC01003946    JAS17397.1    JAS27396.1    JAS33352.1    GDRN01089357    JAI60682.1    AGBW02012523    OWR44939.1    GDRN01089358    JAI60681.1    GEDC01031369    GEDC01020851    GEDC01015209    JAS05929.1    JAS16447.1    JAS22089.1    KK852657    KDR19212.1    LBMM01008317    KMQ88985.1    KQ971351    KYB26811.1    GEZM01051359    GEZM01051357    JAV75016.1    GEZM01051360    GEZM01051358    JAV75010.1    PYGN01000142    PSN52989.1    GEZM01051361    JAV75008.1    GBYX01192625    GBYX01192621    JAO82249.1    ODYU01006474    SOQ48343.1    ACPB03000518    ACPB03000519    GFTR01008985    JAW07441.1    GBGD01000014    JAC88875.1    GGLE01001409    MBY05535.1    HAED01015993    SBR02438.1    KK854264    PTY13912.1    GBYX01192626    GBYX01192622    JAO82248.1    KQ435782    KOX74764.1    KQ435087    KZC14531.1    ADTU01004540    ADTU01004541    ADTU01004542    GANO01000813    JAB59058.1    GL732525    EFX88629.1    KQ983089    KYQ47547.1    BC077078    AAH77078.1    KQ976444    KYM86235.1    CH902618    KPU78180.1    CH379067    KRT07357.1    CAAE01010725    CAF93389.1    BC092742    AAH92742.1    LNIX01000004    OXA56480.1    BC129276    AAI29277.1    FR907704    CDQ87146.1    AK166970    BAE39153.1    KZ288358    PBC27080.1    JXUM01043900    KQ561380    KXJ78773.1    APCN01000204    JXUM01082049    JXUM01082050    JXUM01082051    KQ563286    KXJ74128.1    AAAB01008807    EAA04618.3    CH477380    EAT42216.1    QOIP01000003    RLU24868.1    KK107161    EZA56621.1    CM002912    KMY98410.1    AE014296    AGB94284.1    CM000159    KRK00985.1    CH954178    KQS43439.1    GDUN01000922    JAN94997.1    AHAT01013409    KQ981276    KYN43533.1    GL888120    EGI67012.1    GGMS01012351    MBY81554.1   
Pfam
PF09379   FERM_N        + More
PF16511   FERM_f0
PF00373   FERM_M
PF10545   MADF_DNA_bdg
PF02944   BESS
PF01608   I_LWEQ
PF08913   VBS
PF09141   Talin_middle
PF02174   IRS
PF01044   Vinculin
Interpro
IPR018979   FERM_N        + More
IPR030224   Sla2_fam       
IPR029071   Ubiquitin-like_domsf       
IPR000299   FERM_domain       
IPR014352   FERM/acyl-CoA-bd_prot_sf       
IPR032425   FERM_f0       
IPR019748   FERM_central       
IPR035963   FERM_2       
IPR019749   Band_41_domain       
IPR037843   Kindlin/fermitin       
IPR006578   MADF-dom       
IPR004210   BESS_motif       
IPR019747   FERM_CS       
IPR002558   ILWEQ_dom       
IPR037438   Talin1/2-RS       
IPR015009   Vinculin-bd_dom       
IPR011993   PH-like_dom_sf       
IPR036723   Alpha-catenin/vinculin-like_sf       
IPR035964   I/LWEQ_dom_sf       
IPR015224   Talin_cent       
IPR036476   Talin_cent_sf       
IPR002404   IRS_PTB       
IPR006077   Vinculin/catenin       
SUPFAM
SSF54236   SSF54236        + More
SSF47031   SSF47031       
SSF109880   SSF109880       
SSF47220   SSF47220       
SSF109885   SSF109885       
Gene 3D
PDB
3IVF     E-value=6.70946e-18,     Score=215

Ontologies

Topology

Length:
108
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0002
Exp number, first 60 AAs:
0
Total prob of N-in:
0.31499
outside
1  -  108
 
 

Population Genetic Test Statistics

Pi
137.497782
Theta
141.730401
Tajima's D
0.2531
CLR
7.110675
CSRT
0.44312784360782
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号