Gene

KWMTBOMO15796

Pre Gene Modal

BGIBMGA000034

Annotation

PREDICTED:_ADP-ribosylation_factor-like_protein_3_[Amyelois_transitella]

Location

Bomo_Chr26(+):10268091-10269654      View in EpiBrowser

Full name

ADP-ribosylation factor-like protein 3      

Location in the cell

Nuclear   Reliability : 1.768

CDS

ATGGGTCTGCTAGATATATTAAAGAAACTGCGATCTAATCCGGAGAAAGAGCTTCGTTTGCTGCTGTTAGGGCTGGACAATGCTGGAAAGACGACTCTATTGAAGCAATTGGCTTCGGAAGACGTGAACCACGTTATCCCGACCGCTGGTTTTAATATAAAATCGGTGTTATCGAATGGCTTCAAGCTAAATGTTTGGGATATCGGTGGACAGAGGAAGATCAGGCCTTATTGGAGGAATTATTTTGAGAACACCGATATTTTGATCTACGTGGTCGATTGTTCAGATCACCATAGACTGGAGGAGACCAGTCTAGAATTAGCCGAGCTGCTTCTGGATGACAAGTTGCGCGCTGTTCCGCTGTTAGTTTACGCCAACAAACAGGACTTGGCGACCGGTGCGTATAGATAA

Protein

MGLLDILKKLRSNPEKELRLLLLGLDNAGKTTLLKQLASEDVNHVIPTAGFNIKSVLSNGFKLNVWDIGGQRKIRPYWRNYFENTDILIYVVDCSDHHRLEETSLELAELLLDDKLRAVPLLVYANKQDLATGAYR

Description

Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). Required for normal cytokinesis and cilia signaling. Required for targeting proteins to the ciliary membrane by releasing myristoylated protein from unc119 cargo adapters into the cilium (By similarity).

Similarity

Belongs to the small GTPase superfamily. Arf family.

Keywords

Cell cycle   Cell division   Cell projection   Complete proteome   Cytoplasm   Cytoskeleton   Golgi apparatus   GTP-binding   Lipoprotein   Membrane   Myristate   Nucleotide-binding   Nucleus   Protein transport   Reference proteome   Transport  

Feature

chain  ADP-ribosylation factor-like protein 3

Uniprot

H9IS11   A0A2W1BJH4   A0A2A4JE86   A0A2H1V947   A0A194QDM5   A0A3P8Y8H3   + More
A0A3L8SJ07   A0A218V9N7   B5FYQ0   A0A1V4KIG6   U3K246   A0A3B4A1L8   A0A3B4A179   R0JD26   F7D0F6   A0A1S3L115   A0A2P8ZP50   A0A3Q3Q9L7   F1N9A3   A0A091SKC3   A0A091G3X8   Q8QHI3   A0A1L8FEH6   W5N4R5   V9LC34   A0A1W4WM84   U3J8S9   E0VVB4   G3NFD1   A0A091GP70   B2GR26   Q1MTE5   A0A0S7L578   A0A2I4B4C3   A0A3B4XVC7   H3CFF3   A0A3B4UKR9   A0A2D4P1M1   A0A3B1JF00   A0A3Q2T565   A0A3Q2GQY6   A0A3B4F3F0   A0A3B4ZVI2   A0A3Q2VDK1   A0A3Q4MH85   A0A3Q1IN69   A0A3B3BMY0   A0A3Q3ANJ0   A0A3Q3IU95   A0A3Q3GMB1   A0A3B3H597   A0A3P8RFB6   A0A3P9B5Q4   A0A1A8KSF4   A0A1A8E963   A0A3P9LPN7   A0A1A8GLL5   A0A1A8ARA9   D6X2F7   A0A1A8Q697   A0A1S3Q6Z1   A0A3P8YPN6   A0A3Q1FWJ2   A0A1S3SX14   A0A3Q2Y4Q2   A0A091NJD7   A0A093PWQ4   A0A093H5F8   A0A091EB36   H0ZIT9   A0A1A8P0L0   A0A091NQU6   A0A3Q4BE42   A0A1A8RKC0   A0A091KXI8   A0A099Z0Q6   A0A091V1A4   A0A091HSZ7   A0A091KI48   A0A093FDA8   A0A093JAU1   A0A087QZC2   A0A091ME96   A0A3B1J9A7   A0A3B4D7A1   A0A3B3YEX4   A0A3B3V3Q6   A0A2R7X577   W5UGT3   A0A0L7KVV0   A0A3B4CFE0   A0A3Q2VDK9   A0A1B6GD77   A0A093IMV9   A0A093HFW0   A0A091UP98   A0A093T864   A0A091VEM6   A0A087V995   A0A091J2V1  

Pubmed

19121390    28756777    26354079    25069045    30282656    17018643    + More
25463417    18464734    29403074    15592404    27762356    24402279    23749191    20566863    23594743    15496914    25329095    25186727    29451363    17554307    18362917    19820115    20360741    23127152    26227816   

EMBL

BABH01035561    KZ150146    PZC72890.1    NWSH01001860    PCG69884.1    ODYU01001334    + More
SOQ37373.1    KQ459144    KPJ03653.1    QUSF01000019    RLW02261.1    MUZQ01000028    OWK62302.1    DQ214094    DQ214098    LSYS01003057    OPJ84270.1    AGTO01020393    KB744554    EOA94851.1    PYGN01000005    PSN58282.1    AADN05000306    KK476187    KFQ59059.1    KL447725    KFO76618.1    AF467986    BC087495    CM004479    OCT70000.1    AHAT01023146    AHAT01023147    JW877282    AFP09799.1    ADON01131571    DS235806    EEB17320.1    KL506294    KFO84964.1    BC164965    AAI64965.1    AL928692    BC124704    GBYX01185110    GBYX01185107    JAO84674.1    IACN01036013    LAB51428.1    HAED01005725    HAEE01014524    SBR34574.1    HADZ01001558    HAEA01013164    SBQ41644.1    HAEB01016601    HAEC01003806    SBQ71883.1    HADY01019192    HAEJ01012491    SBP57677.1    KQ971372    EFA10265.2    HAEG01011268    SBR89300.1    KK835030    KFP79387.1    KL669486    KFW76472.1    KL217222    KFV74665.1    KK718105    KFO54381.1    ABQF01027016    HAEI01001129    SBR74813.1    KL390015    KFP91309.1    HAEH01017247    SBS05818.1    KK546302    KFP32439.1    KL886967    KGL74345.1    KK408916    KFQ83548.1    KL217736    KFO98267.1    KK744307    KFP39722.1    KK387638    KFV52221.1    KL205881    KFV76044.1    KL226002    KFM06576.1    KK528189    KFP68894.1    KK857188    PTY26926.1    JT409914    AHH38872.1    JTDY01005255    KOB67191.1    GECZ01009374    JAS60395.1    KK595622    KFW02998.1    KK626404    KFV53528.1    KL409842    KFQ92217.1    KL427788    KFW90754.1    KK733873    KFR00868.1    KL484601    KFO09187.1    KK501486    KFP15314.1   

Proteomes

UP000005204    UP000218220    UP000053268    UP000265140    UP000276834    UP000197619    + More
UP000007754    UP000190648    UP000016665    UP000261520    UP000002279    UP000087266    UP000245037    UP000261600    UP000000539    UP000053760    UP000186698    UP000018468    UP000192223    UP000016666    UP000009046    UP000007635    UP000000437    UP000192220    UP000261360    UP000007303    UP000261420    UP000018467    UP000265000    UP000265020    UP000261460    UP000261400    UP000264840    UP000261580    UP000265040    UP000261560    UP000264800    UP000261660    UP000001038    UP000265100    UP000265160    UP000265180    UP000265200    UP000007266    UP000257200    UP000264820    UP000053258    UP000053875    UP000052976    UP000261620    UP000053641    UP000054308    UP000053584    UP000053286    UP000261440    UP000261480    UP000261500    UP000221080    UP000037510    UP000053283    UP000053605    UP000053119   

PRIDE

H9IS11    B5FYQ0    Q8QHI3    Q1MTE5   

Pfam

PF00025   Arf

Interpro

IPR006689   Small_GTPase_ARF/SAR        + More
IPR005225   Small_GTP-bd_dom       
IPR027417   P-loop_NTPase       

SUPFAM

SSF52540   SSF52540       

ProteinModelPortal

H9IS11   A0A2W1BJH4   A0A2A4JE86   A0A2H1V947   A0A194QDM5   A0A3P8Y8H3   + More
A0A3L8SJ07   A0A218V9N7   B5FYQ0   A0A1V4KIG6   U3K246   A0A3B4A1L8   A0A3B4A179   R0JD26   F7D0F6   A0A1S3L115   A0A2P8ZP50   A0A3Q3Q9L7   F1N9A3   A0A091SKC3   A0A091G3X8   Q8QHI3   A0A1L8FEH6   W5N4R5   V9LC34   A0A1W4WM84   U3J8S9   E0VVB4   G3NFD1   A0A091GP70   B2GR26   Q1MTE5   A0A0S7L578   A0A2I4B4C3   A0A3B4XVC7   H3CFF3   A0A3B4UKR9   A0A2D4P1M1   A0A3B1JF00   A0A3Q2T565   A0A3Q2GQY6   A0A3B4F3F0   A0A3B4ZVI2   A0A3Q2VDK1   A0A3Q4MH85   A0A3Q1IN69   A0A3B3BMY0   A0A3Q3ANJ0   A0A3Q3IU95   A0A3Q3GMB1   A0A3B3H597   A0A3P8RFB6   A0A3P9B5Q4   A0A1A8KSF4   A0A1A8E963   A0A3P9LPN7   A0A1A8GLL5   A0A1A8ARA9   D6X2F7   A0A1A8Q697   A0A1S3Q6Z1   A0A3P8YPN6   A0A3Q1FWJ2   A0A1S3SX14   A0A3Q2Y4Q2   A0A091NJD7   A0A093PWQ4   A0A093H5F8   A0A091EB36   H0ZIT9   A0A1A8P0L0   A0A091NQU6   A0A3Q4BE42   A0A1A8RKC0   A0A091KXI8   A0A099Z0Q6   A0A091V1A4   A0A091HSZ7   A0A091KI48   A0A093FDA8   A0A093JAU1   A0A087QZC2   A0A091ME96   A0A3B1J9A7   A0A3B4D7A1   A0A3B3YEX4   A0A3B3V3Q6   A0A2R7X577   W5UGT3   A0A0L7KVV0   A0A3B4CFE0   A0A3Q2VDK9   A0A1B6GD77   A0A093IMV9   A0A093HFW0   A0A091UP98   A0A093T864   A0A091VEM6   A0A087V995   A0A091J2V1  

PDB

4ZI3     E-value=2.01065e-43,     Score=435

KEGG

101743357    K07944 ADP-ribosylation factor-like protein 3 | (RefSeq) ADP-ribosylation factor-like protein 3

GO

GO:0005525   GO:0007224   GO:0008017   GO:0005881   GO:0005930   GO:0032794   GO:0000281   GO:0005813   GO:0019003   GO:0005634   GO:0007264   GO:0006893   GO:0032391   GO:0042073   GO:0030496   GO:0003924   GO:0036064   GO:1903441   GO:0000287   GO:0005876   GO:0060271   GO:0005794   GO:0042461   GO:0001822   GO:0015031   GO:0005929   GO:0000139   GO:0005737   GO:0015630   GO:0061512   GO:0006892   GO:0005622   GO:0008270   GO:0005215   GO:0006270   GO:0042555   GO:0003707   GO:0006281   GO:0006259  

Subcellular location

Golgi apparatus membrane   Detected predominantly in the photoreceptor connecting cilium. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules. Present on the mitotic spindle (By similarity).   With evidence from 1 publications.
Cytoplasm   Detected predominantly in the photoreceptor connecting cilium. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules. Present on the mitotic spindle (By similarity).   With evidence from 1 publications.
Cytoskeleton   Detected predominantly in the photoreceptor connecting cilium. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules. Present on the mitotic spindle (By similarity).   With evidence from 1 publications.
Spindle   Detected predominantly in the photoreceptor connecting cilium. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules. Present on the mitotic spindle (By similarity).   With evidence from 1 publications.
Nucleus   Detected predominantly in the photoreceptor connecting cilium. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules. Present on the mitotic spindle (By similarity).   With evidence from 1 publications.
Microtubule organizing center   Detected predominantly in the photoreceptor connecting cilium. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules. Present on the mitotic spindle (By similarity).   With evidence from 1 publications.
Centrosome   Detected predominantly in the photoreceptor connecting cilium. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules. Present on the mitotic spindle (By similarity).   With evidence from 1 publications.
Cell projection   Detected predominantly in the photoreceptor connecting cilium. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules. Present on the mitotic spindle (By similarity).   With evidence from 1 publications.
Cilium   Detected predominantly in the photoreceptor connecting cilium. Centrosome-associated throughout the cell cycle. Not detected to interphase microtubules. Present on the mitotic spindle (By similarity).   With evidence from 1 publications.

Length:

136

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.00675

Exp number, first 60 AAs:

0.00511

Total prob of N-in:

0.04773

outside

1  -  136

 

 

Pi

21.368553

Theta

27.491573

Tajima's D

-0.701684

CLR

0.029614

CSRT

0.193790310484476

Interpretation

Uncertain