SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15756
Annotation
endonuclease-reverse_transcriptase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.968
 

Sequence

CDS
ATGGCTAAAAGTTCGATGTCTCAGCTACAGAAGATCTGGAAGAATAGAGGGATAGGCCTGAAAACTAAAACCAGACTGGTGCGGACTCTTGTTTTCTCTATCTTCTTGTATGGAGCTGCGACATGGACGTTGAAAGCAGCAGACCGAATGCGCATCGATGCTTTCGAAATGTGGTGCTGGAGACGCATGCTAAGAATTCCGTGGACAGCCTTCCGGACTAACGTGTCGATATTGAAGCAACTGGGCATCAAAATCAGACTGTCTACTGTATGTCTGAAGCGGATCCTCGAATATTTTGGTTACATTGCGAGGAAAGACGGCGATAACCTGGAAAAACTTATGATCACAGGGAAAGTTGAAGGCAACAGATCTAGAGGCCGCAGCCAGACTCGTTGGTCCGATCAGATCCGCACCGCTTTGGACAGTACAGTGTACAGCACGCTGCATGACGCCGTGGACAGGGGACAGTGGAAAAAAATCCTAAGATTGAAGCTCATGGTGATGGTGGTCACGACCCTCAGACATGAGGAACACGACTCGAGGAGGAGGAGGAGGTAG
Protein
MAKSSMSQLQKIWKNRGIGLKTKTRLVRTLVFSIFLYGAATWTLKAADRMRIDAFEMWCWRRMLRIPWTAFRTNVSILKQLGIKIRLSTVCLKRILEYFGYIARKDGDNLEKLMITGKVEGNRSRGRSQTRWSDQIRTALDSTVYSTLHDAVDRGQWKKILRLKLMVMVVTTLRHEEHDSRRRRR

Summary

Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR000477   RT_dom       
IPR002138   Pept_C14_p10       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
185
Number of predicted TMHs:
1
Exp number of AAs in TMHs:
18.06983
Exp number, first 60 AAs:
17.93437
Total prob of N-in:
0.69094
POSSIBLE N-term signal
sequence
inside
1  -  25
TMhelix
26  -  44
outside
45  -  185
 
 

Population Genetic Test Statistics

Pi
283.935601
Theta
165.082359
Tajima's D
2.264319
CLR
0.256321
CSRT
0.915504224788761
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号