Gene

KWMTBOMO15714  Validated by peptides from experiments

Annotation

PREDICTED:_uncharacterized_protein_LOC105381048_[Plutella_xylostella]

Location

Bomo_Chr26(+):7188242-7192554      View in EpiBrowser

Full name

Proliferation marker protein Ki-67      

Alternative Name

Antigen identified by monoclonal antibody Ki-67

Location in the cell

Cytoplasmic   Reliability : 1.056 Extracellular   Reliability : 1.412 Mitochondrial   Reliability : 1.102

CDS

ATGTCAGGAGGCTGTCTGGTGGTTCTTGACCGTAATGGTCGTTATGTCAAAAAGTACCCGTTGCCTGATGGATTGGCTACATTGGGTAGTGACCCTGCATGTGATATCCGTGTGATGCTACCAACTGTCTGTTCTCATCATGCAACTGTAGTTGTGCATGCTAATCAGACTGTTGTACGAAATATTGGCGATGGCGATACCTTAGTGAATGGAGAGCCTGTGAGTGTGGCAGCGCTTAAGCACTATGATGTGATTACTTTAGGTGATCGATCTCTACGCTGGCATTATGACAATCCAAATATCAGTAAAAAATTCCAGAAGATTGAACAAGGTATGATATTGTTGATTATGAAATTCTTAAAAAACATTATAAGCAAGTACAGTTTTCCTTAA

Protein

MSGGCLVVLDRNGRYVKKYPLPDGLATLGSDPACDIRVMLPTVCSHHATVVVHANQTVVRNIGDGDTLVNGEPVSVAALKHYDVITLGDRSLRWHYDNPNISKKFQKIEQGMILLIMKFLKNIISKYSFP

Description

Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly (PubMed:27362226). Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the chromosome surface (PubMed:27362226). Prevents chromosomes from collapsing into a single chromatin mass by forming a steric and electrostatic charge barrier: the protein has a high net electrical charge and acts as a surfactant, dispersing chromosomes and enabling independent chromosome motility (PubMed:27362226). Binds DNA, with a preference for supercoiled DNA and AT-rich DNA (PubMed:10878551). Does not contribute to the internal structure of mitotic chromosomes (By similarity). May play a role in chromatin organization (PubMed:24867636). It is however unclear whether it plays a direct role in chromatin organization or whether it is an indirect consequence of its function in maintaining mitotic chromosomes dispersed (Probable).

Subunit

Interacts with KIF15 (PubMed:10878014). Interacts (via the FHA domain) with NIFK (PubMed:11342549, PubMed:14659764, PubMed:16244663). Interacts with PPP1CC (PubMed:24867636). Part of a complex composed at least of ASCL2, EMSY, HCFC1, HSPA8, CCAR2, MATR3, MKI67, RBBP5, TUBB2A, WDR5 and ZNF335; this complex may have a histone H3-specific methyltransferase activity (PubMed:19131338, PubMed:23178126).

Keywords

3D-structure   Acetylation   Alternative splicing   ATP-binding   Cell cycle   Chromosome   Complete proteome   DNA-binding   Isopeptide bond   Nucleotide-binding   Nucleus   Phosphoprotein   Polymorphism   Reference proteome   Repeat   Ubl conjugation  

Feature

chain  Proliferation marker protein Ki-67
splice variant  In isoform Short.
sequence variant  In dbSNP:rs2071498.

Uniprot

A0A2W1BHQ3   A0A0N0PBS5   A0A0N1IN47   A0A212FE84   A0A2B4RY07   A0A1B6H0L0   + More
A0A1B6EWL0   A0A093GR25   A0A1B6HL51   A0A1B6L3C4   A7SHF7   A0A1B6G5C1   A0A1B6GV61   A0A3P8PRT5   A0A3Q2W592   F6VDD5   A0A2D4N0H4   A0A2D4N2A9   A0A0S7HQ39   A0A3N1YBA2   A0A091Q5K5   G1SNA0   A0A091GU99   A0A091SWM9   V3ZNX7   A0A091G6S3   H2UYK8   A0A3Q3LFX4   A0A3B5KCG6   B5XEL4   A0A093EPU6   A0A087QZR1   A0A1W2WNZ4   A0A093HWS1   A0A1S2X433   A0A2I4B743   A0A2I4B756   A0A091JLT9   A0A2I4B763   A0A091LBI5   A0A091TG21   A0A093NUD3   A0A091S3L4   A0A091UNR2   A0A087V6V0   I3KVD4   A0A091HVT4   A0A094L8T5   A0A093QBA2   A0A2U9CNQ4   A0A0A0AZQ1   A0A091M352   R7VRK2   A0A099Z8Q1   T2HWM1   H2YXT6   H3D5N7   G1NGY9   A0A2K5RSS1   I3KVD5   A0A315W966   A0A2K5RSQ0   A0A3B3XNF4   A0A3P9Q827   A0A3B3UXP5   A0A087YE19   A0A096M7S8   A0A3Q3AA26   A0A091KWK0   A0A2K6TDP6   A0A2K6TDP7   A0A3Q3FJ07   A0A3B4YLF4   P46013-2   Q4S4N2   P46013   A0A3B4TFH4   A0A093HHV6   A0A3P9JM20   A0A3P9ICG3   A0A3B3IBR9   A0A3P9LGX2   A0A091VGD0   A0A094KNR2   A0A3Q1BRE4   M4AJK8   W7TDZ3   A0A3Q1F9F8   K7FV23   A0A3Q2L9G7   A0A2I3GRS6   A0A2D0S6G5   G1QLE5   F7AFX1   A0A3Q3DIN8   A0A3B5BCL1   F6VGN1  

Pubmed

28756777    26354079    22118469    17615350    12481130    15114417    + More
21993624    23254933    21551351    20433749    25186727    23371554    24019933    15496914    20838655    29703783    8227122    15164054    6339421    6206131    2674163    8799815    9510506    10502411    10878014    10653604    10878551    11342549    15896774    17081983    16964243    17924679    18220336    18691976    18669648    19413330    19131338    19369195    19690332    19608861    20068231    21960707    21406692    23178126    22002106    23186163    24867636    25218447    25114211    25772364    25755297    26680267    27362226    28112733    14659764    16244663    17554307    23542700    23966634    17381049    19892987    20431018   

EMBL

KZ150119    PZC73224.1    KQ460820    KPJ12109.1    KQ459199    KPJ02969.1    + More
AGBW02008963    OWR52066.1    LSMT01000290    PFX21132.1    GECZ01001553    JAS68216.1    GECZ01027395    JAS42374.1    KL217011    KFV72758.1    GECU01032300    JAS75406.1    GEBQ01021780    JAT18197.1    DS469659    EDO36884.1    GECZ01012131    JAS57638.1    GECZ01003463    JAS66306.1    EAAA01001584    IACM01135423    LAB39155.1    IACM01135424    LAB39156.1    GBYX01438309    JAO43044.1    RJVI01000001    ROR34677.1    KK687464    KFQ15185.1    KL513362    KFO87191.1    KK489663    KFQ63084.1    KB201977    ESO93083.1    KL447873    KFO78090.1    BT049483    ACI69284.2    KK366919    KFV41544.1    KL226002    KFM06715.1    KK636914    KFV58953.1    KK501100    KFP12666.1    KL308756    KFP52673.1    KK449719    KFQ72825.1    KL225167    KFW68393.1    KK939502    KFQ49578.1    KL409816    KFQ92012.1    KL482157    KFO08342.1    AERX01002294    AERX01002295    KL217818    KFO99269.1    KL281907    KFZ67728.1    KL418178    KFW85876.1    CP026260    AWP17479.1    KL873581    KGL99417.1    KK516965    KFP65074.1    KB375595    EMC84126.1    KL891498    KGL78864.1    AB775130    BAN83908.1    NHOQ01000843    PWA28382.1    AYCK01000749    AYCK01000750    KK544981    KFP32064.1    X65550    X65551    AL355529    AL390236    X94762    CAAE01014738    CAG04400.1    KL206121    KFV79030.1    KK733934    KFR01508.1    KL353206    KFZ60260.1    AZIL01001014    EWM25215.1    AGCU01074131    ADFV01087722    AAMC01014933    AAMC01014934   

Proteomes

UP000053240    UP000053268    UP000007151    UP000225706    UP000053875    UP000001593    + More
UP000265100    UP000264840    UP000008144    UP000276634    UP000001811    UP000030746    UP000053760    UP000005226    UP000261640    UP000053286    UP000087266    UP000192220    UP000053119    UP000054081    UP000053283    UP000005207    UP000054308    UP000246464    UP000053858    UP000053641    UP000007875    UP000007303    UP000001645    UP000233040    UP000261480    UP000242638    UP000261500    UP000028760    UP000264800    UP000233220    UP000261660    UP000261360    UP000005640    UP000261420    UP000053584    UP000265200    UP000001038    UP000265180    UP000053605    UP000257160    UP000002852    UP000257200    UP000007267    UP000002281    UP000001073    UP000221080    UP000008143    UP000264820    UP000261400   

PRIDE

P46013   

Pfam

PF16697   Yop-YscD_cpl        + More
PF00498   FHA
PF15276   PP1_bind
PF08065   KI67R

Interpro

IPR000253   FHA_dom        + More
IPR032030   YscD_cytoplasmic_dom       
IPR008984   SMAD_FHA_dom_sf       
IPR029334   PP1-bd       
IPR012568   KI67R       
IPR017956   AT_hook_DNA-bd_motif       

SUPFAM

SSF49879   SSF49879       

CDD

cd00060  FHA

ProteinModelPortal

A0A2W1BHQ3   A0A0N0PBS5   A0A0N1IN47   A0A212FE84   A0A2B4RY07   A0A1B6H0L0   + More
A0A1B6EWL0   A0A093GR25   A0A1B6HL51   A0A1B6L3C4   A7SHF7   A0A1B6G5C1   A0A1B6GV61   A0A3P8PRT5   A0A3Q2W592   F6VDD5   A0A2D4N0H4   A0A2D4N2A9   A0A0S7HQ39   A0A3N1YBA2   A0A091Q5K5   G1SNA0   A0A091GU99   A0A091SWM9   V3ZNX7   A0A091G6S3   H2UYK8   A0A3Q3LFX4   A0A3B5KCG6   B5XEL4   A0A093EPU6   A0A087QZR1   A0A1W2WNZ4   A0A093HWS1   A0A1S2X433   A0A2I4B743   A0A2I4B756   A0A091JLT9   A0A2I4B763   A0A091LBI5   A0A091TG21   A0A093NUD3   A0A091S3L4   A0A091UNR2   A0A087V6V0   I3KVD4   A0A091HVT4   A0A094L8T5   A0A093QBA2   A0A2U9CNQ4   A0A0A0AZQ1   A0A091M352   R7VRK2   A0A099Z8Q1   T2HWM1   H2YXT6   H3D5N7   G1NGY9   A0A2K5RSS1   I3KVD5   A0A315W966   A0A2K5RSQ0   A0A3B3XNF4   A0A3P9Q827   A0A3B3UXP5   A0A087YE19   A0A096M7S8   A0A3Q3AA26   A0A091KWK0   A0A2K6TDP6   A0A2K6TDP7   A0A3Q3FJ07   A0A3B4YLF4   P46013-2   Q4S4N2   P46013   A0A3B4TFH4   A0A093HHV6   A0A3P9JM20   A0A3P9ICG3   A0A3B3IBR9   A0A3P9LGX2   A0A091VGD0   A0A094KNR2   A0A3Q1BRE4   M4AJK8   W7TDZ3   A0A3Q1F9F8   K7FV23   A0A3Q2L9G7   A0A2I3GRS6   A0A2D0S6G5   G1QLE5   F7AFX1   A0A3Q3DIN8   A0A3B5BCL1   F6VGN1  

PDB

1R21     E-value=3.23365e-09,     Score=140

KEGG

101739006    K17582 antigen KI-67 | (RefSeq) serine/arginine repetitive matrix protein 2-like

GO

GO:0016021   GO:0016604   GO:0005730   GO:0051983   GO:0007088   GO:0008022   GO:0000793   GO:0008283   GO:0016020   GO:0003723   GO:0007049   GO:0005524   GO:0003677   GO:1902275   GO:0005634   GO:0005694   GO:0005515   GO:0007010   GO:0020037   GO:0004983   GO:0006270   GO:0042555   GO:0003707   GO:0006281   GO:0006259  

Subcellular location

Chromosome   Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the mitotic chromosome surface (PubMed:27362226). Associates with satellite DNA in G1 phase (PubMed:9510506). Binds tightly to chromatin in interphase, chromatin-binding decreases in mitosis when it associates with the surface of the condensed chromosomes (PubMed:15896774, PubMed:22002106). Predominantly localized in the G1 phase in the perinucleolar region, in the later phases it is also detected throughout the nuclear interior, being predominantly localized in the nuclear matrix (PubMed:22002106).   With evidence from 30 publications.
Nucleus   Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the mitotic chromosome surface (PubMed:27362226). Associates with satellite DNA in G1 phase (PubMed:9510506). Binds tightly to chromatin in interphase, chromatin-binding decreases in mitosis when it associates with the surface of the condensed chromosomes (PubMed:15896774, PubMed:22002106). Predominantly localized in the G1 phase in the perinucleolar region, in the later phases it is also detected throughout the nuclear interior, being predominantly localized in the nuclear matrix (PubMed:22002106).   With evidence from 30 publications.
Nucleolus   Associates with the surface of the mitotic chromosome, the perichromosomal layer, and covers a substantial fraction of the mitotic chromosome surface (PubMed:27362226). Associates with satellite DNA in G1 phase (PubMed:9510506). Binds tightly to chromatin in interphase, chromatin-binding decreases in mitosis when it associates with the surface of the condensed chromosomes (PubMed:15896774, PubMed:22002106). Predominantly localized in the G1 phase in the perinucleolar region, in the later phases it is also detected throughout the nuclear interior, being predominantly localized in the nuclear matrix (PubMed:22002106).   With evidence from 30 publications.

Length:

130

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.02773

Exp number, first 60 AAs:

0.00423

Total prob of N-in:

0.04551

outside

1  -  130

 

 

Pi

213.460627

Theta

184.434231

Tajima's D

-0.793491

CLR

0

CSRT

0.179491025448728

Interpretation

Uncertain