SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15638
Annotation
PREDICTED:_uncharacterized_protein_LOC105842659_[Bombyx_mori]
Location in the cell
Cytoplasmic   Reliability : 1.089
 

Sequence

CDS
ATGCGCAAGACCCTAGAAAACTGGGATGGAGGCATAACCATAGGTGGTGTCAAAGTGACGAACCTGCGCTACGCAGATGACACCACTCTGCTTGCCACAACAGAAGCAGAGATGACAGAGCTTCTGAACAGGATGGAGCAGATAGGGTTGGAGATGGGACTCGCCATCAACAGATCCAAAACTAAGATCATGGTCATTGATCGCACAAAAAAGTTGGAGCTTAGTGGAACACTAAACCTTGAGCTTGTTGACAACTTTATTTACCTAGGCTCCAACATTAACAATACTGGATCCAGCGAACTTGAAGTACGACGGCGTATTGGAATGGCAAAGGGAGCCATGACCCAGCTCGGTAAAATCTGGAAGGACCATAACATTACCCAGAAAACAAAGACAAAACTGGTGCTCACTCTGGTCTTTTCCATTTTTATATACGGAACGGAGACCTGGACCCTTAAAGCAGCTGATCGCAAACGCGTGGATGCTTTTGAGATGTGGTGCTAG
Protein
MRKTLENWDGGITIGGVKVTNLRYADDTTLLATTEAEMTELLNRMEQIGLEMGLAINRSKTKIMVIDRTKKLELSGTLNLELVDNFIYLGSNINNTGSSELEVRRRIGMAKGAMTQLGKIWKDHNITQKTKTKLVLTLVFSIFIYGTETWTLKAADRKRVDAFEMWC

Summary

Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
Interpro
IPR036691   Endo/exonu/phosph_ase_sf        + More
IPR000477   RT_dom       
IPR002138   Pept_C14_p10       
IPR005135   Endo/exonuclease/phosphatase       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
167
Number of predicted TMHs:
1
Exp number of AAs in TMHs:
15.56111
Exp number, first 60 AAs:
0.00308
Total prob of N-in:
0.84277
inside
1  -  133
TMhelix
134  -  152
outside
153  -  167
 
 

Population Genetic Test Statistics

Pi
270.858541
Theta
139.69194
Tajima's D
2.950554
CLR
0
CSRT
0.977001149942503
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号