Gene

KWMTBOMO15550

Pre Gene Modal

BGIBMGA010807

Annotation

putative_calponin-like_and_microtubule-associated_protein_[Danaus_plexippus]

Location

Bomo_Chr26(+):2313000-2313954      View in EpiBrowser

Full name

Sperm flagellar protein 1      

Alternative Name

Calponin-homology and microtubule-associated protein

Location in the cell

Extracellular   Reliability : 2.906

CDS

ATGTCTAATATAGACTCTCCTATAGCTCTCGCCGAGTTAGAGTCGGTTCTGGCCTGGGTGGATACATTCAAGCTCTCTAGACCGACCAAGAAAATCAACAGAGATTTTTCCGATGCTGTTCTCCTAGCCGAGATCCTAAGCGTTCATTATCCGAAACTAGTGGAAATGCACAACTATCCGCCGAGGAACAGCCATTCTTTGAAGCTCAACAACTGGCTGACGCTTAACCGCAAGGTTCTGAAGAAGTTGAGGCTGAGCCTATGCTGTAACACAATGGATCAGCTCGCTAATTGCGCTCCAGGGGTCATTGAACGAGTACTTGTCATGGGTTAG

Protein

MSNIDSPIALAELESVLAWVDTFKLSRPTKKINRDFSDAVLLAEILSVHYPKLVEMHNYPPRNSHSLKLNNWLTLNRKVLKKLRLSLCCNTMDQLANCAPGVIERVLVMG

Description

Microtubule-associated protein involved in the stabilization of microtubules along the axis of migration during radial intercalation. Promotes the establishment and stabilization of an axis of microtubules required for the active migration of cells into the outer epithelium (By similarity). Microtubule-associated protein that promotes microtubule bundling and stabilizes microtubules against depolymerization in response to cold shock (By similarity).
Microtubule-associated protein involved in the stabilization of microtubules along the axis of migration during radial intercalation. Promotes the establishment and stabilization of an axis of microtubules required for the active migration of cells into the outer epithelium (PubMed:25070955). Microtubule-associated protein that promotes microtubule bundling and stabilizes microtubules against depolymerization in response to cold shock (By similarity).
Microtubule-associated protein that promotes microtubule bundling and stabilizes microtubules against depolymerization in response to cold shock (PubMed:16206169). Microtubule-associated protein involved in the stabilization of microtubules along the axis of migration during radial intercalation. Promotes the establishment and stabilization of an axis of microtubules required for the active migration of cells into the outer epithelium (By similarity).

Miscellaneous

Radial intercalation is a developmentally reiterated form of migration by which cells move in a direction orthogonal to the plane of the tissue from an inner layer to an outer layer.

Keywords

3D-structure   Alternative splicing   Cell projection   Cilium   Complete proteome   Cytoplasm   Cytoskeleton   Flagellum   Reference proteome  

Feature

chain  Sperm flagellar protein 1
splice variant  In isoform 2.

Uniprot

H9JMQ4   A0A212F1H5   A0A3S2NSS7   A0A2W1BVB4   A0A2A4JXK1   A0A2H1VQZ5   + More
A0A0L7L9U7   A0A194PRD9   D6X1I2   A0A1Y1KPI8   H3G827   A0A1S3ES56   K3WKI8   N6UP25   H2P1B7   A0A337S9Q4   Q9Y4P9-2   A0A2K5II77   A0A2K6CQ04   A0A2K5P1I1   G7N2V1   G7PGV5   A0A2K5Z0X7   A0A195FLG9   G3QSQ8   Q9Y4P9   A0A384B8E2   A0A2K6MTK7   A0A2K6QSD7   A0A2F0BJ29   A0A2J8RZU8   U3DM62   A0A2K5Z100   A0A1L8HKE9   L5JX33   B2R9F7   E2R239   A0A2K6MTK9   Q4KLL8   A0A3Q7TSH4   A0A2K6FRP1   D3K5J5   A0A096NVC0   A0A2Y9ISU1   A0A2R9B943   A0A2Y9PZ43   H0WXY8   A0A3Q2KK73   A0A384B9I2   H2QJW3   A0A0D9RKK7   M3YBE6   Q58DA1   L8IQ48   A0A2Y9H6H8   A0A2U3Z7N9   W5NTK6   A0A212CA85   A0A384B8C5   A0A341B9R5   A0A2Y9F9A2   L8YCL6   A0A2I3MGV5   A0A286X7Y2   A0A2Y9DYP3   D2HAB5   Q0IH24   A0A1L8HSL4   A0A1R2BRG6   A0A0B8RWZ6   Q99JL1   A0A2K6S245   F6S0V8   A0A1W4W4T6   A0A158NEX4   G3V8V9   A0A091CNJ5   A0A2K5EWJ0   A0A340XW91   N6TX48   A0A2Y9PZL7   F6ZW13   A0A026WSN1   I3M761   V4A3I2   G4YWS5   G1PAW0   S7N7N7   A0A1U7Q9H2   A0A2U3ZDJ2   L5M8D9   A0A3P4MEL7   G5B4U6   A0A3Q7PEN2   A0A1U7U3S0   A0A341BB81   A0A3Q7W1N3   A0A384D4F1   A0A3Q7PNY2   A0A2Y9PZM6  

Pubmed

19121390    22118469    28756777    26227816    26354079    18362917    + More
19820115    28004739    16946064    23537049    17975172    11230166    17974005    11780052    15489334    15979255    22002653    22398555    25362486    25243066    27762356    23258410    16341006    30723633    22722832    19892987    16136131    16305752    22751099    20809919    23385571    21993624    20010809    19767740    25070955    25476704    16141072    19468303    16206169    21347285    15057822    15632090    24508170    30249741    23254933    21993625   

EMBL

BABH01016717    AGBW02010875    OWR47587.1    RSAL01000098    RVE47629.1    KZ149936    + More
PZC77137.1    NWSH01000419    PCG76529.1    ODYU01003647    SOQ42664.1    JTDY01002030    KOB72278.1    KQ459601    KPI93695.1    KQ971371    EFA09498.1    GEZM01081628    JAV61575.1    DS566925    GL376633    APGK01002430    KB734775    ENN83505.1    ABGA01041202    ABGA01081322    AANG04003379    AL080154    EF560745    AL109804    CH471133    BC022476    CM001262    EHH19883.1    AQIA01008316    CM001285    EHH65511.1    KQ981490    KYN41107.1    CABD030115340    NTJE010230481    MBW02999.1    NDHI03003628    PNJ14032.1    GAMS01008690    JAB14446.1    CM004467    OCT96562.1    KB031072    ELK03999.1    AK313766    BAG36504.1    AAEX03013827    BC099127    AAH99127.1    AEMK02000106    GU373673    DQIR01104117    ADC38873.1    HDA59593.1    AHZZ02000551    AJFE02073130    AAQR03053900    AACZ04064998    NBAG03000245    PNI62438.1    AQIB01152506    AEYP01079616    BT021696    BC118201    JH880965    ELR57644.1    AMGL01025439    MKHE01000023    OWK02896.1    KB364366    ELV12834.1    AAKN02012818    ACTA01066973    GL192628    EFB15454.1    BC123353    CM004466    OCT99085.1    MPUH01000476    OMJ79340.1    GBSH01002593    JAG66433.1    AY860964    AK016476    AK046964    AK047675    AL831736    BC006046    ADTU01013276    AC110439    CH473949    EDL80226.1    KN124706    KFO20524.1    APGK01048120    KB741098    KB632368    ENN73890.1    ERL93695.1    KK107119    QOIP01000009    EZA58656.1    RLU18275.1    AGTP01017776    KB201262    ESO98403.1    JH159152    EGZ23795.1    AAPE02032388    KE163658    EPQ12991.1    KB103138    ELK34525.1    CYRY02011904    VCW79387.1    JH168482    EHB04307.1   

Proteomes

UP000005204    UP000007151    UP000283053    UP000218220    UP000037510    UP000053268    + More
UP000007266    UP000005238    UP000081671    UP000019118    UP000001595    UP000011712    UP000005640    UP000233080    UP000233120    UP000233060    UP000009130    UP000233100    UP000233140    UP000078541    UP000001519    UP000261681    UP000233180    UP000233200    UP000008225    UP000186698    UP000010552    UP000002254    UP000286640    UP000233160    UP000008227    UP000028761    UP000248482    UP000240080    UP000248483    UP000005225    UP000002281    UP000002277    UP000029965    UP000000715    UP000009136    UP000248481    UP000245341    UP000002356    UP000252040    UP000248484    UP000011518    UP000005447    UP000248480    UP000008912    UP000000589    UP000233220    UP000192223    UP000005205    UP000002494    UP000028990    UP000233020    UP000265300    UP000030742    UP000053097    UP000279307    UP000005215    UP000030746    UP000002640    UP000001074    UP000189706    UP000245340    UP000006813    UP000286641    UP000189704    UP000286642    UP000261680   

PRIDE

H9JMQ4    Q9Y4P9    Q58DA1    Q99JL1    F6ZW13   

Pfam

PF06294   CH_2

Interpro

IPR001715   CH-domain        + More
IPR036872   CH_dom_sf       
IPR010441   CH_2       

SUPFAM

SSF47576   SSF47576       

Gene 3D

1.10.418.10    

ProteinModelPortal

H9JMQ4   A0A212F1H5   A0A3S2NSS7   A0A2W1BVB4   A0A2A4JXK1   A0A2H1VQZ5   + More
A0A0L7L9U7   A0A194PRD9   D6X1I2   A0A1Y1KPI8   H3G827   A0A1S3ES56   K3WKI8   N6UP25   H2P1B7   A0A337S9Q4   Q9Y4P9-2   A0A2K5II77   A0A2K6CQ04   A0A2K5P1I1   G7N2V1   G7PGV5   A0A2K5Z0X7   A0A195FLG9   G3QSQ8   Q9Y4P9   A0A384B8E2   A0A2K6MTK7   A0A2K6QSD7   A0A2F0BJ29   A0A2J8RZU8   U3DM62   A0A2K5Z100   A0A1L8HKE9   L5JX33   B2R9F7   E2R239   A0A2K6MTK9   Q4KLL8   A0A3Q7TSH4   A0A2K6FRP1   D3K5J5   A0A096NVC0   A0A2Y9ISU1   A0A2R9B943   A0A2Y9PZ43   H0WXY8   A0A3Q2KK73   A0A384B9I2   H2QJW3   A0A0D9RKK7   M3YBE6   Q58DA1   L8IQ48   A0A2Y9H6H8   A0A2U3Z7N9   W5NTK6   A0A212CA85   A0A384B8C5   A0A341B9R5   A0A2Y9F9A2   L8YCL6   A0A2I3MGV5   A0A286X7Y2   A0A2Y9DYP3   D2HAB5   Q0IH24   A0A1L8HSL4   A0A1R2BRG6   A0A0B8RWZ6   Q99JL1   A0A2K6S245   F6S0V8   A0A1W4W4T6   A0A158NEX4   G3V8V9   A0A091CNJ5   A0A2K5EWJ0   A0A340XW91   N6TX48   A0A2Y9PZL7   F6ZW13   A0A026WSN1   I3M761   V4A3I2   G4YWS5   G1PAW0   S7N7N7   A0A1U7Q9H2   A0A2U3ZDJ2   L5M8D9   A0A3P4MEL7   G5B4U6   A0A3Q7PEN2   A0A1U7U3S0   A0A341BB81   A0A3Q7W1N3   A0A384D4F1   A0A3Q7PNY2   A0A2Y9PZM6  

PDB

2EE7     E-value=5.55819e-24,     Score=268

KEGG

101737660    no KO assigned | (RefSeq) sperm flagellar protein 1-like

GO

GO:0031514   GO:0008017   GO:0051493   GO:0005930   GO:0060285   GO:0007026   GO:0005737   GO:0016477   GO:0005515   GO:0003899   GO:0006351   GO:0032549   GO:0022857   GO:0007165   GO:0006418   GO:0003707   GO:0006281   GO:0006259  

Subcellular location

Cytoplasm   Present in the tails of developing and epididymal sperm, internal to the fibrous sheath and around the outer dense fibers of the sperm flagellum. Also found at the apical tip of cilia (By similarity).   With evidence from 2 publications.
Cell projection   Present in the tails of developing and epididymal sperm, internal to the fibrous sheath and around the outer dense fibers of the sperm flagellum. Also found at the apical tip of cilia (By similarity).   With evidence from 2 publications.
Cilium   Present in the tails of developing and epididymal sperm, internal to the fibrous sheath and around the outer dense fibers of the sperm flagellum. Also found at the apical tip of cilia (By similarity).   With evidence from 2 publications.
Flagellum   Present in the tails of developing and epididymal sperm, internal to the fibrous sheath and around the outer dense fibers of the sperm flagellum. Also found at the apical tip of cilia (By similarity).   With evidence from 2 publications.
Cytoskeleton   Present in the tails of developing and epididymal sperm, internal to the fibrous sheath and around the outer dense fibers of the sperm flagellum. Also found at the apical tip of cilia (By similarity).   With evidence from 2 publications.
Cilium axoneme   Present in the tails of developing and epididymal sperm, internal to the fibrous sheath and around the outer dense fibers of the sperm flagellum. Also found at the apical tip of cilia (By similarity).   With evidence from 2 publications.
  

Length:

110

Number of predicted TMHs:

0

Exp number of AAs in TMHs:

0.01058

Exp number, first 60 AAs:

0.00685

Total prob of N-in:

0.10155

outside

1  -  110

 

 

Pi

133.604605

Theta

149.340504

Tajima's D

-0.36761

CLR

0.219498

CSRT

0.270586470676466

Interpretation

Uncertain