SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15492  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA010763
Annotation
aminopeptidase_N_precursor_[Bombyx_mori]
Full name
Aminopeptidase      
Location in the cell
PlasmaMembrane   Reliability : 1.328
 

Sequence

CDS
ATGGCGTGCTTGCATTTTATTTTATTGTTGTCCTGTGCGCTGCTGTCCACGGGCGAATACCTGCTGCCCGGCGATGTGGTGCCGACATTCTACGACGTGCTCCTCATTTACGACGTGGATCCGGCGACGAACTTCAGCTACTTCGGCCGTGTCGACATTAAATTAAACATCCTCAAACCGACCTCAAAGATCGTGCTCCACGCGCAAGGCTTCAGCATACCGGAAGAGGAAGTGACCCTGACAGGGCCCAAGGAGGTGGCAGTTGACAATGTCAAACTGAACGACACGTTCAATTTATTGACACTGTCGCTGAGTCAGCAGTTGGATGAAGGCGACAACTACGTGCTGCGAATACCTTTCTACGGCAATCTGCAGCAAGATCTGGATGGGACCTACATCAGTAAATACGTCGATAAGAAAACAAAGAAAAATGAATATTTGGTGACGACGCAATTCGAGGCGATATCAGCTAGAAAAGGTTTCCCGTGCTTTGACGAACCGATGTACAAGGCGCCCTTCAAGATATCCATCGGCCATCACATCAATTATGTTGCCGTTTCCAACATGCCTCTAGTGTCGACGGATAATTATAATGTCCTGGAGGAAACATGGCCTTGGAAAACTATCGGACAAAAGTTCAATAAAGCCGTTTACGATTTCGTCTGGGACCACTTCGACGTGTCCCTGTCAATGTCAACGTATCTCGTCGCTTACGTCATTTCGAAGTTCACATACGAGGAGAGCCCGCCCGAGCTGTCCGACACTAAGTTCAGGATCTGGGCTAACAAGGACACTATTGACCAGGCCGCCTACGCTAAGTCGATAGCGCCAAAAGTGCTGACACACTTCGAGAAGTGGTTCGACGTGAAATACCCGCTGCCTAAACAGGACATGATCGCCATTCCGGACTTCGCGGCCGGCGCCATGGAGAACTGGGGCCTCATAACCTACAGGGAGACCACCTTGCTCTACGATAAGAAGCACTCCTCGTTCTTGAACAAGGAAAGAGTAGCAGAGGTGATAGCGCACGAGCTGGCCCACCAGTGGTTCGGGAACCTGGTCACGATGAAGTGGTGGTCCGACCTGTGGCTGAACGAGGGGTTCGCGACGTACGCGGCGTCCGTGGGCGTGGCGGCCGTGGAGCCCACGTGGCGCGCGGACAACAACTACGCCGTCGACAACATGCTGGCCGTGCTCAACCTCGACGCCTTGGAGTCTTCGCACCCTGTGTCGGTCACAATAGACGACCCGAAGCGCATCTTCGAGATATTCGATGAGATCTCGTACAAGAAGGGCTCCACACTCATCAGGATGATGGTCATGTTCCTCGGAGAAGACGTCTTCAGGAAAGCCATTAAAAATTACCTCGTGAAGTACACGTTGAAGAACGCCGAACAAGATGACCTGTGGCACGAGCTCACTGAAGAGAGTAAGAGGCAGGGAGGGATCGCGAACAACGTGACCATCAAGGAGATAATGGACACGTGGACCACGCAAACCGGATACCCGATCCTGACCGTCACCAGGGATTATATAGACAAGTCTGTCAGCGTCACTCAGCGGCGGTACTTGTCGCTGGGGGCGCGCGCGGCGTCGCACCGCTCGTGGTGGGTGCCACTGCGCGTGGCGGCCGCGGGCGAGCAGCCCGAGCCCTCGCTGCACTGGCTCGCGACGCACCAGGGCCTGGACGAGCCCTACCGCTTCCCGCACGACGCAGAGCCCACCGACTGGATGCTCTTCAATCCCGATATGATCGCACCTTATCGCGTCAATTATGATGCTCGTAACTGGGAACTTCTTTCGGAGACACTGCTCAGCGACAAGTACGATGAGATCCCAGTACTGGGCAGAGTGCAACTGATATCGGACGCCTTCGCTCTGGCGGCCACCAACAGACTCAACTATTCCACTACACTGATTCTTGCAAGCTACCTCCAGAGAGAGAGGGAGTACCTGCCTCTGTCGACAGCGCTGAGAGGGTTGGCCAAGATTGAGAACCTCTTGAAGCGCAGCGGAGACTACAGCGCCTTCCAGAGCTACATCAGGCATCTGGTGCAGAACTCGTATCGAAGGGCTGGAGGCCTCTCCGTCAAGCGTATCGTTAATGGCGACGATCTGAACAGCGTAAAACTGCAGGTGTTGACCAGCGGCTGGGCCTGTCGCGCGCTGATACCGGGCTGCGAGGAAAACGCCATGGAGCTGTTCCAAATGTGGATGAACACTTCCAATCCGGATGAAAATAATCCGCAAGTTTTCTTTATTTTTTCATCTAAGGACACGATCGATGGGGATCACAAGTCGATGTCTCAATTTAAAACGACCCGCGCGGGGATGAAGATCCCGCTGGACCTGCGGCGCACGGTGTGGTGCGCGGGCGCGGCGCGCGGCGGCGAGCGCGAGTGGCGCTTCCTCACGCTGCGGCTGCAGGCCGCGCGCGTTGCCGCCGCCCGCGACGCCATGCTCGCCGCCATGGCCTGCACCAGGCAGGTCTGGCTGCTCAACCAGTTCCTCGAATGGGCGGTGTCGGAGAACTCCCCGGTGCGCAAGCAGGACGCGGCCGCCGTGGTCGGTAACGTGGCCCGCACGCCGGTCGGCTACTACGTCGCGCGGGAGTTCTTCTACAACCGAATCGACGATCTGTTTAAGACTTTCAACGGTCAGAGCCGCCGTTTCGGCTATATCATCAAGACTCTGCTGGACCAGTTCACGACTCAGAGAGAATTGGACGAGTTTCTCATTTTCCACGACAAGAACCCTAAATATTTCGAGGAGACGAAGCTGGCCGTCGTTCAGGCGATTGAGAAAGCCAAAGTGAACATCGACTGGGTCGACCAAAACAAAGATTTAGTTATGAGTGAATAA
Protein
MACLHFILLLSCALLSTGEYLLPGDVVPTFYDVLLIYDVDPATNFSYFGRVDIKLNILKPTSKIVLHAQGFSIPEEEVTLTGPKEVAVDNVKLNDTFNLLTLSLSQQLDEGDNYVLRIPFYGNLQQDLDGTYISKYVDKKTKKNEYLVTTQFEAISARKGFPCFDEPMYKAPFKISIGHHINYVAVSNMPLVSTDNYNVLEETWPWKTIGQKFNKAVYDFVWDHFDVSLSMSTYLVAYVISKFTYEESPPELSDTKFRIWANKDTIDQAAYAKSIAPKVLTHFEKWFDVKYPLPKQDMIAIPDFAAGAMENWGLITYRETTLLYDKKHSSFLNKERVAEVIAHELAHQWFGNLVTMKWWSDLWLNEGFATYAASVGVAAVEPTWRADNNYAVDNMLAVLNLDALESSHPVSVTIDDPKRIFEIFDEISYKKGSTLIRMMVMFLGEDVFRKAIKNYLVKYTLKNAEQDDLWHELTEESKRQGGIANNVTIKEIMDTWTTQTGYPILTVTRDYIDKSVSVTQRRYLSLGARAASHRSWWVPLRVAAAGEQPEPSLHWLATHQGLDEPYRFPHDAEPTDWMLFNPDMIAPYRVNYDARNWELLSETLLSDKYDEIPVLGRVQLISDAFALAATNRLNYSTTLILASYLQREREYLPLSTALRGLAKIENLLKRSGDYSAFQSYIRHLVQNSYRRAGGLSVKRIVNGDDLNSVKLQVLTSGWACRALIPGCEENAMELFQMWMNTSNPDENNPQVFFIFSSKDTIDGDHKSMSQFKTTRAGMKIPLDLRRTVWCAGAARGGEREWRFLTLRLQAARVAAARDAMLAAMACTRQVWLLNQFLEWAVSENSPVRKQDAAAVVGNVARTPVGYYVAREFFYNRIDDLFKTFNGQSRRFGYIIKTLLDQFTTQRELDEFLIFHDKNPKYFEETKLAVVQAIEKAKVNIDWVDQNKDLVMSE

Summary

Cofactor
Zn(2+)
Similarity
Belongs to the peptidase M1 family.
Feature
chain  Aminopeptidase
EC Number
3.4.11.-
EMBL
JQ061154    AFK85028.1    MF319742    ASJ26456.1    KZ149908    PZC78228.1    + More
AGBW02011488    OWR46566.1    KQ461003    KPJ10021.1    KQ459601    KPI93655.1    NWSH01000721    PCG74619.1    ODYU01002553    SOQ40207.1    KQ971311    EEZ99336.1    KU932234    APA33870.1    MF741655    AVD96938.1    GEDC01016064    JAS21234.1    GECU01035837    JAS71869.1    GEZM01046358    GEZM01046357    JAV77303.1    GFXV01004127    MBW15932.1    DS235745    EEB16222.1    APGK01027780    APGK01027781    APGK01027782    APGK01027783    APGK01027784    APGK01027785    KB740671    ENN79629.1    ABLF02020109    GDHF01016887    JAI35427.1    GBXI01008343    JAD05949.1    GAKP01019737    JAC39215.1    GDHF01029538    JAI22776.1    CVRI01000060    CRL03858.1    CRL03857.1    GAMC01009092    JAB97463.1    GANO01002430    JAB57441.1    GEBQ01015299    JAT24678.1    AXCN02001411    CH477852    EAT35628.1    GFTR01008306    JAW08120.1    JXUM01080917    KQ563216    KXJ74267.1    CH902623    EDV30519.1    CH916377    EDV90757.1    CH933806    EDW16218.2    ATLV01021848    KE525324    KFB46929.1    KRG01998.1    ABLF02013994    KY031093    ATU82844.1    AAAB01008963    EAA12046.5    UFQS01000417    UFQT01000417    SSX03766.1    SSX24131.1    OUUW01000005    SPP81333.1    ADMH02001160    ETN63860.1    CH964251    KRF99732.1    EDW83104.2    CM000364    EDX14833.1    CM000070    EAL26872.1    GFDL01004639    JAV30406.1    AF231040    AAF34809.1    GBBI01003749    JAC14963.1    CH480819    EDW53344.1    AE014297    BT133378    AAF56884.1    AFH36363.1    CH940656    EDW58572.1    CH479186    EDW39068.1    CH954182    EDV53234.1    CP012526    ALC47157.1    CM000160    EDW98311.1    SSX03765.1    SSX24130.1    BT014634    AAT27258.1    EDV30518.1    GDKW01002163    JAI54432.1    GBGD01000392    JAC88497.1    KRK04205.1    GFTR01008270    JAW08156.1    GECZ01009731    JAS60038.1    EDW98315.1    EDV53237.1    GECL01003570    JAP02554.1    EDV53235.1    LJIG01022766    KRT78825.1    JRES01001565    KNC22036.1    EDX14832.1    KRK04208.1    EDW98314.1    KRK04210.1    EDW98312.1    EDX14831.1    GL446946    EFN87052.1    APCN01004903    DS232472    EDS42294.1   
Pfam
PF11838   ERAP1_C        + More
PF01433   Peptidase_M1
Interpro
IPR042097   Aminopeptidase_N-like_N        + More
IPR024571   ERAP1-like_C_dom       
IPR014782   Peptidase_M1_dom       
IPR034016   M1_APN-typ       
IPR001930   Peptidase_M1       
IPR033581   APN2       
Gene 3D
PDB
6BV4     E-value=4.81329e-136,     Score=1245

Ontologies

Topology

SignalP
Position:   1 - 18,         Likelihood:  0.977212
 
 
Length:
953
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.961269999999999
Exp number, first 60 AAs:
0.95679
Total prob of N-in:
0.04433
outside
1  -  953
 
 

Population Genetic Test Statistics

Pi
220.398907
Theta
160.095999
Tajima's D
-0.844946
CLR
0.26506
CSRT
0.165741712914354
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
25044914 FPGYIGAHVAYIHAIDSPTDPK 95.45 2e-10
29197581 FGYIIK 95.45 2e-10
26822097 IWANKDTIDQAAYAK 100.00 8e-04
25044914 KGFCFITFESEQVVNDIIK 100.00 8e-04
29197581 IWANKDTIDQAAYAK 100.00 8e-04
26822097 NAEQDDIWHEITEESKR 100.00 0.002
25044914 IVYTIQEIR 100.00 0.002
28467696 IVYSTCSFNPIENEAVIIR 100.00 0.002
29197581 IVIHAQGFSIPEEEVTITGPK 100.00 0.002
26822097 EVAVDNVK 100.00 0.004
25044914 GFNSIIGSHYDHYYIDYEDYNIDEIDPDVFK 100.00 0.004
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号