SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15477
Annotation
PREDICTED:_uncharacterized_protein_LOC106713229_[Papilio_machaon]
Location in the cell
PlasmaMembrane   Reliability : 1.918
 

Sequence

CDS
ATGGGTCAATTACCTAAAACTCGTACTGATTTACAATTTCCTTTCTTGAATTGTAGTGTGGATTATGCTGGGCCAATTTTGATCGCTGATCGTAAAGGGCGAGGCTGTAAATTAGTAAAATCATACTTATGCATTTTTGTGTGCCTTGCAGTAAAAGCTGTTCATATCGAGCTCGTCACCGCATTGTCATCGGAGGCGTACATAGCTGCTCTCAAAAGATTCGTGTCTCGTCGAGGCAAGCCCCGCAGCATATGGTCCGACAATGGGACAAATTTTGTTGGTGCTTGCAACGAACTCAAAGGCGTCCTTTCAAACTCAGACATTGCGTCATTCATGTCTCAAGAAGGCATAGATTTTAATTTTTCTCCACCTTATTCCCCTCATTTTAATGGTCTGGCTGAAGCAGCGGTTAAGGCCACTAAAGGCCATCTCAAAAAACTCCTCGGTCTTACTCACCTCACGTATGAAGAAATGTCTTCGTGCTTATGTCAAATTGAGGCCATTCTAAATTCCCGTCCACTTACTCCTATTTCCTCTGATCCGTTAGATTTAACTGCCCTTACTCCTGCTCACTTTCTGATTGGACGACCGCTCACGTCAGTTCCGCACCCGCAGATTACCGACGGCAACATCACGCGCTTGGAGCGCTACCAACGAGTGGAACTCATCAGGCAGCATTTTTGGAAGCGCTTTATTAATGAATACATGTCTCTGCTACAGCAGAAATCTAAATGGTCCACCTCTACAGGGAGCTTGATACCAGGGACGCTAGTCCTTGTGAAGGACAGGACGCTACCGGCTCTGTTGTGGCCTTTGGGCCGCATTACCAAGACGTATCCGGGCAGCGACGGCATCACACGGGTCGCAGAGGTCAAGACGAGGACGGGGACCGTGGTGCGAGGCTTCAACTCCATTTGCCCCCTCCCTCTTCATTGA
Protein
MGQLPKTRTDLQFPFLNCSVDYAGPILIADRKGRGCKLVKSYLCIFVCLAVKAVHIELVTALSSEAYIAALKRFVSRRGKPRSIWSDNGTNFVGACNELKGVLSNSDIASFMSQEGIDFNFSPPYSPHFNGLAEAAVKATKGHLKKLLGLTHLTYEEMSSCLCQIEAILNSRPLTPISSDPLDLTALTPAHFLIGRPLTSVPHPQITDGNITRLERYQRVELIRQHFWKRFINEYMSLLQQKSKWSTSTGSLIPGTLVLVKDRTLPALLWPLGRITKTYPGSDGITRVAEVKTRTGTVVRGFNSICPLPLH

Summary

EMBL
KQ460205    KPJ16960.1    KQ459256    KPJ02096.1    KQ459312    KPJ01687.1    + More
NWSH01001014    PCG73111.1    RSAL01000222    RVE44041.1    KQ460500    KPJ14270.1    GEZM01086715    GEZM01086714    JAV59022.1    NWSH01001945    PCG69607.1    KQ460970    KPJ10166.1    KQ458793    KPJ04955.1    LKEX01009270    KYN50062.1    GAIX01006818    JAA85742.1    KQ978749    KYN28625.1    LBMM01005768    KMQ91222.1    GBHO01037808    JAG05796.1    KQ976863    KYN07859.1    GEZM01039657    JAV81297.1    LHQN01026481    KOC58676.1    KQ460211    KPJ16510.1    GEZM01013857    JAV92285.1    GL769615    EFZ10365.1    GBHO01042877    JAG00727.1    LBMM01012392    KMQ86241.1    KQ414603    KOC69644.1    LBMM01009941    KMQ87772.1    KQ978276    KYM95705.1    KQ979340    KYN21881.1    GEZM01068861    GEZM01068860    JAV66730.1    LBMM01009062    KMQ88421.1    LBMM01009284    KMQ88247.1    LBMM01005719    KMQ91270.1    KMQ91271.1    KQ977667    KYN00648.1    IAAA01044800    LAA09890.1    KQ414692    KOC63602.1    KQ978591    KYN29960.1    GEZM01018697    JAV90052.1    GBHO01005508    GBHO01005504    JAG38096.1    JAG38100.1    GALX01006326    JAB62140.1    GEZM01018627    GEZM01018626    GEZM01018625    GEZM01018622    GEZM01018621    GEZM01018620    GEZM01018617    GEZM01018616    GEZM01018615    GEZM01018614    GEZM01018613    GEZM01018610    GEZM01018608    GEZM01018607    GEZM01018605    JAV90136.1    GEZM01021505    JAV88969.1    NWSH01006923    PCG63188.1    JXUM01175059    KQ581415    KXJ62573.1    LBMM01016323    KMQ84470.1    PCG63186.1    KQ980379    KYN16310.1    GECL01000456    JAP05668.1    KQ971371    EFA09479.1    GEDC01002296    GEDC01002113    JAS35002.1    JAS35185.1    LNIX01000063    OXA37199.1    GGMR01020322    MBY32941.1    GEZM01018702    JAV90048.1    GEZM01066272    JAV68024.1    JXUM01245428    KQ636870    KXJ62407.1    GEZM01052807    JAV74268.1    GGMR01010464    MBY23083.1    LKEX01009172    KYN50051.1    LNIX01000005    OXA54454.1    LNIX01000016    OXA46198.1    GGMR01014052    MBY26671.1    LNIX01000069    OXA36894.1    JXUM01161881    KQ574228    KXJ67877.1    GDHF01028680    JAI23634.1    GDHF01013863    JAI38451.1    LJIG01022633    KRT79529.1    QOIP01000010    RLU18065.1    LNIX01000007    OXA51795.1    LBMM01008181    KMQ89076.1    GEZM01018628    JAV90116.1    IAAA01066606    LAA12316.1    KQ973442    KXZ75531.1    GG695382    EFA13346.1    LBMM01009098    KMQ88394.1    OXA54414.1    LBMM01015711    KMQ84701.1    KQ980343    KYN16364.1    GEZM01018619    JAV90138.1    GL442026    EFN64015.1    LNIX01000002    OXA60848.1    KQ978021    KYM98106.1    ABLF02026857    ABLF02013940    ABLF02036313    ABLF02066938    ABLF02066950    LBMM01008872    KMQ88567.1    ABLF02018371    GEDC01022769    JAS14529.1    GEZM01018629    GEZM01018623    JAV90127.1    IAAA01053765    LAA11244.1    GECZ01005654    JAS64115.1    LBMM01019751    KMQ83463.1    GFTR01005058    JAW11368.1    GBBI01004211    JAC14501.1    KQ977096    KYN05838.1    LBMM01006671    KMQ90403.1    OXA59522.1    GEZM01054765    JAV73413.1    KQ977375    KYN03201.1    LNIX01000018    OXA45284.1    GGMR01009502    MBY22121.1    JXUM01150485    KQ571012    KXJ68260.1    LBMM01018813    KMQ83687.1   
Pfam
PF05585   DUF1758        + More
PF03564   DUF1759
PF18701   DUF5641
PF00665   rve
PF05380   Peptidase_A17
PF17921   Integrase_H2C2
PF00078   RVT_1
PF00067   p450
Interpro
IPR040676   DUF5641        + More
IPR008737   Peptidase_asp_put       
IPR036397   RNaseH_sf       
IPR005312   DUF1759       
IPR001584   Integrase_cat-core       
IPR008042   Retrotrans_Pao       
IPR012337   RNaseH-like_sf       
IPR041588   Integrase_H2C2       
IPR001878   Znf_CCHC       
IPR021109   Peptidase_aspartic_dom_sf       
IPR001995   Peptidase_A2_cat       
IPR001606   ARID_dom       
IPR000477   RT_dom       
IPR036875   Znf_CCHC_sf       
IPR001128   Cyt_P450       
IPR036396   Cyt_P450_sf       
SUPFAM
SSF53098   SSF53098        + More
SSF57756   SSF57756       
SSF48264   SSF48264       
Gene 3D

Ontologies

Topology

Length:
311
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
11.72678
Exp number, first 60 AAs:
10.39938
Total prob of N-in:
0.52707
POSSIBLE N-term signal
sequence
outside
1  -  311
 
 

Population Genetic Test Statistics

Pi
187.636323
Theta
151.765804
Tajima's D
0.726108
CLR
0
CSRT
0.579671016449178
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号