SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15451
Pre Gene Modal
BGIBMGA004767
Annotation
PREDICTED:_nephrin-like_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 2.791
 

Sequence

CDS
ATGGACGCCAAGACCAGAAGCCACACTCGACTACTAGAGCCCTACAACGAGGGAGATACCCTGGAACTTATTTGCGAAACATATGGTGGTGATCCAAGGCCCAGTGTGACTTGGTACTTGGAGAACACCGTCATCGACGACTCATTTGAGCAGCGCCCTGACGGAGTGACTGTCAACACCCTGACCTTCCCCAGTGTTGGTCGTCAGCATCTCAACGCAAGGCTCGTCTGTCAAGCTTCGAACACAAATCTAGCGCCACCGGAAACTAAGCTTTTAATACTTGATATAAACTTAAGGCCACTCAGCGTGCAGATCTTGAATAAGAGGCCGGAGCTTTCCGCAGACAGGACTTATGAACTTGAGTGCAAGACTACTGGATCCCGGCCCGAAGCTCAAGTTACGTGGTGGAAAGGTGGAAGACAATACAAAAGGAGTGCAGCCAAAAATTTCTCCGAGAGCAACGCAACGACCAGCGTCCTAACGTTTGTGCCTGTCGCCGAGGACCACGAGAAGACCCTGGTCTGTCGCGCCGAGAACCCCAGCGTGGTGGAATCATCGATAGAAGACAAATGGAAAATGAACGTGCATTATAACCCATCAAGATTAAACTTAGAAAAAAACTACTGA
Protein
MDAKTRSHTRLLEPYNEGDTLELICETYGGDPRPSVTWYLENTVIDDSFEQRPDGVTVNTLTFPSVGRQHLNARLVCQASNTNLAPPETKLLILDINLRPLSVQILNKRPELSADRTYELECKTTGSRPEAQVTWWKGGRQYKRSAAKNFSESNATTSVLTFVPVAEDHEKTLVCRAENPSVVESSIEDKWKMNVHYNPSRLNLEKNY

Summary

EMBL
KQ459596    KPI95282.1    AGBW02013965    OWR42507.1    BABH01028139    BABH01028110    + More
BABH01028111    NWSH01001734    PCG70297.1    AGBW02008416    OWR53449.1    KQ460118    KPJ17690.1    KPI95281.1    ODYU01008707    SOQ52514.1    NWSH01000804    PCG74103.1    RSAL01000001    RVE55293.1    AJWK01009649    AJWK01009650    AJWK01009651    GBHO01002348    GDHC01008300    JAG41256.1    JAQ10329.1    GBRD01006221    JAG59600.1    GEZM01002471    JAV97235.1    KQ971354    EFA06826.2    CVRI01000006    CRK88297.1    AXCM01006148    NEVH01020344    PNF21423.1    KPJ17689.1    KK852551    KDR21492.1    JXJN01020724    JXJN01020725    JXJN01020726    APGK01045656    APGK01045657    APGK01045658    APGK01045659    KB741037    ENN74692.1    KQ434809    KZC06717.1    ADMH02000629    ETN65555.1    APCN01000864    AXCN02001176    UFQT01000721    SSX26761.1    KB631716    ERL85567.1    PNF21422.1    DS231868    EDS40777.1    AJWK01035068    AJWK01035069    AJWK01035070    SSX26760.1    GEDC01028050    JAS09248.1    CH902617    KPU79298.1    CH964272    EDW84074.1    CH477492    EAT40016.1    JRES01001160    KNC24967.1    AAAB01008987    EAA01081.5    CH940652    KRF78738.1    EDW59180.1    KRF78739.1    KRF78740.1    CP012526    ALC47181.1    GEHC01000109    JAV47536.1    EDV41691.1    KPU79296.1    KPU79297.1    KPU79299.1    CM000070    KRT00496.1    GBXI01011571    JAD02721.1    GAKP01006691    JAC52261.1    GDHF01029500    JAI22814.1    GDHF01028633    GDHF01000289    JAI23681.1    JAI52025.1    CH479179    EDW24155.1    BT071799    ACN43735.2    GAMC01011313    JAB95242.1    EAL28149.2    KRT00494.1    KRT00495.1    KRT00497.1    CH933806    EDW14590.1    KRG01093.1    KRG01094.1    OUUW01000013    SPP87858.1    CH916369    EDV92962.1    GL435917    EFN72486.1    DS235315    EEB14623.1    CH954181    EDV49222.1    CM000364    EDX13063.1    AE014297    AAF54952.3    AFH06404.1    CH480815    EDW42308.1    CM000160    EDW97249.1    KRK03606.1    KQ436043    KOX67494.1    GEBQ01019020    JAT20957.1    QOIP01000001    RLU26636.1    JTDY01000215    KOB78250.1    KQ977791    KYM99751.1    GECZ01013250    JAS56519.1    KQ976703    KYM77198.1    ADTU01022145    ADTU01022146    ADTU01022147    ADTU01022148    ADTU01022149    ADTU01022150    ADTU01022151    ADTU01022152    NNAY01000092    OXU31062.1    KQ414740    KOC62013.1    SSX26763.1    GL888115    EGI67145.1    SSX26762.1   
Pfam
PF08205   C2-set_2        + More
PF07686   V-set
PF07679   I-set
PF00047   ig
PF00041   fn3
Interpro
IPR013162   CD80_C2-set        + More
IPR013783   Ig-like_fold       
IPR003599   Ig_sub       
IPR007110   Ig-like_dom       
IPR036179   Ig-like_dom_sf       
IPR003598   Ig_sub2       
IPR036116   FN3_sf       
IPR003961   FN3_dom       
IPR013106   Ig_V-set       
IPR013098   Ig_I-set       
IPR013151   Immunoglobulin       
SUPFAM
SSF48726   SSF48726        + More
SSF49265   SSF49265       
Gene 3D
PDB
4OFY     E-value=1.06074e-09,     Score=148

Ontologies

Topology

Length:
208
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00566
Exp number, first 60 AAs:
0
Total prob of N-in:
0.49627
outside
1  -  208
 
 

Population Genetic Test Statistics

Pi
225.042735
Theta
159.815033
Tajima's D
1.13928
CLR
0.715831
CSRT
0.699715014249288
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号