SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15416
Pre Gene Modal
BGIBMGA006113
Annotation
PREDICTED:_uncharacterized_protein_LOC106713976_[Papilio_machaon]
Location in the cell
Nuclear   Reliability : 3.488
 

Sequence

CDS
ATGCCTGAAGGCAAAGTAAAAGACTTAATTAAAAGGAGGGCCTCAATAAAGGCCAAAATAACACAATTCTCTACGTATTTGGATGTCCTACGGGGTTGTGATTATTTCAATGATGTGCAATTCTCGGAACTCCAAGTACGTCTTGAGAAATTCGAAACCTTATACGGGGACTTCGACAGTTTTCAGAGTGAGATCGAGATGCTGTCAGACGCGCCGGAAGACCATTATAAGGATCGTGAGTCCATTGAGTCGCAGTACTACAAGCTTGTGGCTTCTGCGCGTACGCTGTTGGATCAACGCAAAAATAATGACGGTAGGTCCGAGGAACACTTCCTGTACGCGTGCGAGTCTTTTAGAAGTTTGTCGATTGAAACACGTATTAGGAAAGCAAAGGAGCTTAGAGTGTGCCTTAACTGTCTGAGGCCTGGACACACTGATTCTCAATATCTTACTAAATTTTGGGAGCTAGACTCTATACCATCTTCAACAATCAACGATTTAAATAGTCATCCGTGTGAAAAGGTGTTCATTGAAACTACAACGCGCGCTGAAGACGGACGCTTTAACGTGACCTTACCTTTCCATGAATCACCAAAATGTTTAGGAGACTCGTACTATATGGCCAAGCACCGTCGTACCCTTCCTTCCGATTTGGCAGAGCAAGAGATTAAATTTTCTTTTATACCGGCATACACACCACATTTTGGCGGACTTTGGGAGTCAGCCGTTAGGTCTACGAAATATCACTTGCGTAGAACTTTAGGGCTAACACATCTCACATTTGAAGAAATGACGACTTTATTAACTCAAATTGAAGCCATTTTAAATTCAAGGCCTCTCATTCCTCTGTCAGATGATCCTTCGGACTATTATCCTCTCACTCCAGCTCATTTCCTAATAGGACGATCTTTACTCTTTGTACCTCAGCCTGATTTAACAAATCATTCAACTTTAACCTCTCTTAAGAGATTCCAGCGTATCGAGTACCTTAAGCAGCATTTTTGGCAGCGATTCTCCAATGAGTACGTCGTGTGGCTACAACAAAAAATGAAATGGCCGACTCAAAAGGGAGACTTAAAAGAAGGTATGATGGTTGTCATCAAGGAGAAGGGACTACCACCTCTTATGTGGCTGCTCGGACGCATTATTCGTCTTTGTCCTGGACGAGATGGAATTACACGTGTGGCAGATATCTTAACCAAGAAAGGTGTTATACGACGCGCTTACAACAACATATGCCCGCTACCAGTCAATATTTGA
Protein
MPEGKVKDLIKRRASIKAKITQFSTYLDVLRGCDYFNDVQFSELQVRLEKFETLYGDFDSFQSEIEMLSDAPEDHYKDRESIESQYYKLVASARTLLDQRKNNDGRSEEHFLYACESFRSLSIETRIRKAKELRVCLNCLRPGHTDSQYLTKFWELDSIPSSTINDLNSHPCEKVFIETTTRAEDGRFNVTLPFHESPKCLGDSYYMAKHRRTLPSDLAEQEIKFSFIPAYTPHFGGLWESAVRSTKYHLRRTLGLTHLTFEEMTTLLTQIEAILNSRPLIPLSDDPSDYYPLTPAHFLIGRSLLFVPQPDLTNHSTLTSLKRFQRIEYLKQHFWQRFSNEYVVWLQQKMKWPTQKGDLKEGMMVVIKEKGLPPLMWLLGRIIRLCPGRDGITRVADILTKKGVIRRAYNNICPLPVNI

Summary

Uniprot
Pfam
PF03564   DUF1759        + More
PF18701   DUF5641
Interpro
IPR012337   RNaseH-like_sf        + More
IPR005312   DUF1759       
IPR036397   RNaseH_sf       
IPR040676   DUF5641       
SUPFAM
SSF53098   SSF53098       
Gene 3D
ProteinModelPortal

Ontologies

Topology

Length:
419
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00394
Exp number, first 60 AAs:
0.00027
Total prob of N-in:
0.00344
outside
1  -  419
 
 

Population Genetic Test Statistics

Pi
257.594342
Theta
181.709778
Tajima's D
1.223049
CLR
0.393889
CSRT
0.722913854307285
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号