SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15303
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.66 Nuclear   Reliability : 1.058
 

Sequence

CDS
ATGACCATTAACGCTGGCGTTCCACAAGGTTCGGTGCTCTCCCCCACGCTTTTCATCTTGTATATCAATGACATGCTGTCTATTTATGGCATGCATTGCTATGCGGATGACAGCACGGGGGATGTGCGATATATCGGCCATCAGATTCTCTCACGGAGCGTAGTGCAGGAGAGACATTCAAAACTTGTGTTTGAAGTGGAGAACTCTCTGGGGCGAGCCTCCGAGTGGGGTGAAGTAAATTTGGTTCAATTCAACCCGTTGAAGACACAGGTTTGCGCGTTCACTGCGAAGAAGGACCCCTTTGTCATGGCGCCGCAATTCCAAGGTGTATCCCTACAACCTTCCAAGAATATTGGGATACTTGGGCTCGACATTTCGAGCGATGTCCAATTTCGGAGTCATTTGGAGGGCAAAGCCAAGTTGGCGTCAAAAATGCTGGGAGTCCTCAACAGAGCGAAGCGGTACTTCACGCCTGGACAAAGACTTTTGCTTTACAAAGCACAGGTCCGGCATCGCGTAGAGTACTGCTCCCATTTCTGGGCCGGGGCTCCCAAATACCAGCTACTTCCATTTGATTCCATACAGAAAAGAGCCGTTCGGATTGTTGATAATCCCATTCTTACGGATCGATTGGAACCTCTGGGTCTGCGGAGGGACTTCAGTTTCCTCTGTATTTTGTACCGTATGTTCCATGGGGAGTGCTCAGAGGAATTGTTCGAGATGATACCAACATCTCGTTTTTACCATCGAACCTCCCGCCACCGGAGTAAAGTTCATCCATACTACGTGGTGCCACTACATTCATCCACAGTGCGTTTCCAGAGATCTTTTTTGCCACGTACCATCCGGCTATGA
Protein
MTINAGVPQGSVLSPTLFILYINDMLSIYGMHCYADDSTGDVRYIGHQILSRSVVQERHSKLVFEVENSLGRASEWGEVNLVQFNPLKTQVCAFTAKKDPFVMAPQFQGVSLQPSKNIGILGLDISSDVQFRSHLEGKAKLASKMLGVLNRAKRYFTPGQRLLLYKAQVRHRVEYCSHFWAGAPKYQLLPFDSIQKRAVRIVDNPILTDRLEPLGLRRDFSFLCILYRMFHGECSEELFEMIPTSRFYHRTSRHRSKVHPYYVVPLHSSTVRFQRSFLPRTIRL

Summary

Cofactor
pyridoxal 5'-phosphate
EMBL
AY359886    AAQ57129.1    RSAL01002067    RVE40593.1    RSAL01000487    RVE41561.1    + More
RSAL01000422    RVE41792.1    RSAL01000090    RVE48098.1    RSAL01000002    RVE54942.1    RSAL01003136    RVE40332.1    RVE55041.1    RVE55094.1    RSAL01000171    RVE45150.1    RSAL01000164    RVE45343.1    ODYU01002162    SOQ39302.1    GDRN01105059    JAI57791.1    DPOC01000269    HCX22453.1    ODYU01007423    SOQ50184.1    AMCI01002135    EJX03495.1    HAAD01001474    CDG67706.1    GFAC01000919    JAT98269.1    LWDP01000391    ORD92879.1    RSAL01000193    RVE44603.1    GEFM01002394    JAP73402.1    HAAD01000593    CDG66825.1    GEGO01001118    JAR94286.1    GEGO01004630    JAR90774.1    GEFM01002419    JAP73377.1    GEFM01002324    JAP73472.1    GADI01001229    JAA72579.1    GDRN01111278    JAI56803.1    GDRN01111277    JAI56804.1    GEGO01002473    JAR92931.1    GFAC01005665    JAT93523.1    GEFM01006421    JAP69375.1    GBIH01002577    JAC92133.1    GEGO01003312    JAR92092.1    GFAA01002657    JAU00778.1    GFAA01002479    JAU00956.1    FLMD02000154    SCV66010.1    GEGO01005479    JAR89925.1    GEFM01006250    JAP69546.1    GFAA01002514    JAU00921.1    GACK01003803    JAA61231.1    GANP01010944    JAB73524.1    GEGO01004295    JAR91109.1    FLMD02000280    SCV66640.1    GEFM01006417    JAP69379.1    GFAC01005646    JAT93542.1    GEGO01007187    JAR88217.1    MRZV01000639    PIK46517.1    GCES01126385    JAQ59937.1    GCES01143686    JAQ42636.1    GCES01099194    JAQ87128.1    GFAA01003161    JAU00274.1    LSMT01000297    PFX20951.1    GEGO01004056    JAR91348.1    GEFM01005904    JAP69892.1    NSIT01000239    PJE78188.1    GCES01108388    JAQ77934.1    GDRN01111334    JAI56796.1    NSIT01000412    PJE77717.1    GFAC01000861    JAT98327.1    GFAC01005670    JAT93518.1    GEGO01003518    JAR91886.1    GEFM01002397    JAP73399.1    GFAA01002726    JAU00709.1    GEGO01003895    JAR91509.1    GEGO01007438    JAR87966.1    LSMT01000193    PFX23886.1    GEGO01003658    JAR91746.1    GFAA01000066    JAU03369.1    GEGO01003794    JAR91610.1    GEGO01004248    JAR91156.1    GEGO01003274    JAR92130.1    GEGO01004132    JAR91272.1    GDRN01111326    JAI56798.1    GEGO01003427    JAR91977.1    NSIT01000271    PJE78081.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01585   G-patch
PF04939   RRS1
PF00282   Pyridoxal_deC
PF01873   eIF-5_eIF-2B
PF08159   NUC153
PF00458   WHEP-TRS
PF02460   Patched
PF00096   zf-C2H2
PF03372   Exo_endo_phos
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR007023   Ribosom_reg       
IPR015424   PyrdxlP-dep_Trfase       
IPR002129   PyrdxlP-dep_de-COase       
IPR021115   Pyridoxal-P_BS       
IPR015421   PyrdxlP-dep_Trfase_major       
IPR015422   PyrdxlP-dep_Trfase_dom1       
IPR010977   Aromatic_deC       
IPR016190   Transl_init_fac_IF2/IF5_Zn-bd       
IPR002735   Transl_init_fac_IF2/IF5       
IPR016189   Transl_init_fac_IF2/IF5_N       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR000738   WHEP-TRS_dom       
IPR009068   S15_NS1_RNA-bd       
IPR030223   Dispatched       
IPR003392   Ptc/Disp       
IPR000731   SSD       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
SUPFAM
SSF56219   SSF56219        + More
SSF54928   SSF54928       
SSF53383   SSF53383       
SSF75689   SSF75689       
SSF100966   SSF100966       
SSF50978   SSF50978       
SSF47060   SSF47060       
SSF57667   SSF57667       

Ontologies

Topology

Length:
284
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
2.75782000000001
Exp number, first 60 AAs:
2.75514
Total prob of N-in:
0.11091
outside
1  -  284
 
 

Population Genetic Test Statistics

Pi
64.111382
Theta
73.031216
Tajima's D
-0.88497
CLR
9.643332
CSRT
0.159742012899355
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号