SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15266
Pre Gene Modal
BGIBMGA005031
Annotation
PREDICTED:_hemicentin-1-like_[Amyelois_transitella]
Location in the cell
Cytoplasmic   Reliability : 1.238 Extracellular   Reliability : 1.147
 

Sequence

CDS
ATGTGGTCGGTAAAGTGGATCAGGCTATTAGTGATGCTGGCAGCGTGCTGGGCTCAAGAAGGCGAGTGGAGTGAAGATGCTGAAGACTTGGTGTCGACAGTCGACGTTGACGCGGTGTTGGGGCGCACTGCCTCCCTGCCCTGTGACGTCACACCAGACGCTATTGAAGATCGCGTCTACATGGTGCTCTGGTTCAGAGCGGGAAAAGCCACGGGTGGAAAACCTATATACAGGTTAGTTCATCATATTCAATAA
Protein
MWSVKWIRLLVMLAACWAQEGEWSEDAEDLVSTVDVDAVLGRTASLPCDVTPDAIEDRVYMVLWFRAGKATGGKPIYRLVHHIQ

Summary

Pfam
PF07686   V-set        + More
PF08205   C2-set_2
PF00047   ig
Interpro
IPR013106   Ig_V-set        + More
IPR036179   Ig-like_dom_sf       
IPR003598   Ig_sub2       
IPR013162   CD80_C2-set       
IPR013783   Ig-like_fold       
IPR003599   Ig_sub       
IPR007110   Ig-like_dom       
IPR013151   Immunoglobulin       
IPR036116   FN3_sf       
IPR003961   FN3_dom       
SUPFAM
SSF48726   SSF48726        + More
SSF49265   SSF49265       
Gene 3D

Ontologies

Topology

SignalP
Position:   1 - 18,         Likelihood:  0.994563
 
 
Length:
84
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00635
Exp number, first 60 AAs:
0.00284
Total prob of N-in:
0.26040
outside
1  -  84
 
 

Population Genetic Test Statistics

Pi
29.063624
Theta
47.382913
Tajima's D
-1.336395
CLR
2000.662625
CSRT
0.0838458077096145
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号