SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15263
Pre Gene Modal
BGIBMGA009757
Annotation
PREDICTED:_mucin-2-like_[Amyelois_transitella]
Location in the cell
Nuclear   Reliability : 3.679
 

Sequence

CDS
ATGAAACACATTCCTAAAGAAAAAAGACAGAAATGGGACAAAAAGTCTGAACAATGCATACTTATAGGCTATCCTGAAGATGTTAAGGGATACCGTATATACAATCCTGCAACACAGAGCATCACAACAAGTCGAGATGTTATATTTATAGAAGAAAATAACTTAGATGAACAGAAAATCATTGAAATAAAAGAAGATGATTTAAGTAATAAATCATTGTCACCTTCAGTGGGAGATTTACCGGACACCAGTAGGGAGGATTCATTTACTTCAGCTGAAAATGCTACTGACTTGGATGAAACCTACGTACCATCTTCTGAGGATGAGGAGTCCTTGAAATTAGAAAAAGACCTGCTGAGAACATTACCGAAAAGGCACAGAAAGCAACCTGACAGATATGGATATATGTGTACAGAAGAATGTAACAATCCAGTCAGAGATGAATTGACATTAGAAGAGGCACTGGAAGGACCAGAAAAGGAGCACTGGGAACAGGCTATCAAAGAAGAACTGAAAAGTTTTGAAGACAACAAGGCATGGGATATTGTTGACGTTCCTGTAAGTGGCAACATTGTAAAGTGCAAGTGGGTTCTTAAAAAGAAATACGATGCTGAAAATAATGTGCGATATCGAGCGAGACTTGTGGCTAAAGGTTGTTCACAAAGATATGGTGAGGACTACAGTGAAACTTTCTCTCCTGTGGTGCGGCATACAACACTTAGATTATTATTTGCTTTATCAGTGCAGATGAACCTGAAAGTGATTCATCTTGATGTAAAAACTGCCTTCTTGAATGGAGATCTGTCTGAGACTATATACATGCAAAAACCTACAGGCTATGTCTGTAAAGATGATAAAAAGGTTCTTAAATTAAACAAAGCTATATATGGTCTCAAGCAGGCTTCACGAGCATGGTATATGAAGGTTGATGCTTTAAAACTATTGTAA
Protein
MKHIPKEKRQKWDKKSEQCILIGYPEDVKGYRIYNPATQSITTSRDVIFIEENNLDEQKIIEIKEDDLSNKSLSPSVGDLPDTSREDSFTSAENATDLDETYVPSSEDEESLKLEKDLLRTLPKRHRKQPDRYGYMCTEECNNPVRDELTLEEALEGPEKEHWEQAIKEELKSFEDNKAWDIVDVPVSGNIVKCKWVLKKKYDAENNVRYRARLVAKGCSQRYGEDYSETFSPVVRHTTLRLLFALSVQMNLKVIHLDVKTAFLNGDLSETIYMQKPTGYVCKDDKKVLKLNKAIYGLKQASRAWYMKVDALKLL

Summary

EMBL
GEZM01011855    JAV93396.1    GEZM01011856    JAV93393.1    GEZM01082909    JAV61231.1    + More
AGBW02010203    OWR48976.1    GEZM01011859    JAV93384.1    KQ460297    KPJ16236.1    GEZM01011857    JAV93390.1    KQ460882    KPJ11482.1    GBHO01019780    JAG23824.1    GBHO01019781    JAG23823.1    GBHO01036544    JAG07060.1    GDHC01011760    JAQ06869.1    JXUM01118474    KQ566190    KXJ70335.1    KA648745    AFP63374.1    GBYB01005195    JAG74962.1    DNYX01000169    HBK83011.1    LBMM01004924    KMQ91985.1    GAKP01015352    JAC43600.1    NWSH01000816    PCG74073.1    GBHO01019985    JAG23619.1    D83003    BAA11674.1    OIVN01002984    SPD07941.1    LBMM01014433    KMQ85183.1    OIVN01002854    SPD06945.1    OIVN01006189    SPD27343.1    OIVN01002268    SPD02135.1    LBMM01013184    KMQ85774.1    OIVN01004614    SPD18379.1    OIVN01003897    SPD14257.1    OIVN01002564    SPD04723.1    OIVN01002137    SPD00935.1    OIVN01004921    SPD19975.1    OIVN01002940    SPD07631.1    OIVN01000183    SPC75833.1    OIVN01001484    SPC94512.1    OIVN01000395    SPC79545.1    OIVN01005068    SPD20708.1    OIVN01002491    SPD04083.1    OIVN01000191    SPC75975.1    OIVN01001130    SPC90232.1    OIVN01006238    SPD28613.1    OIVN01001196    SPC91020.1    OIVN01000189    SPC75922.1    OIVN01001666    SPC96375.1    GEZM01045163    GEZM01045162    JAV77888.1    OIVN01000095    SPC74169.1    OIVN01001890    SPC98658.1    OIVN01001091    SPC89740.1    OIVN01001520    SPC94877.1    OIVN01000557    SPC82046.1    OIVN01000958    SPC87933.1    OIVN01000404    SPC79669.1    OIVN01000116    SPC74628.1    OIVN01002247    SPD01987.1    OIVN01001202    SPC91100.1    OIVN01004420    SPD17230.1    OIVN01000147    SPC75222.1    OIVN01002444    SPD03657.1    OIVN01005334    SPD21977.1    OIVN01001052    SPC89229.1    OIVN01000866    SPC86622.1    LXQA010007518    MCH84877.1    OIVN01001534    SPC95017.1    OIVN01001636    SPC96102.1    OIVN01000080    SPC73890.1    PSQE01000007    RHN45312.1    GBHO01016859    JAG26745.1    GBHO01043059    JAG00545.1    OIVN01002547    SPD04547.1    OIVN01006468    SPD33689.1    OIVN01003569    SPD12194.1    OIVN01005646    SPD23424.1    OIVN01001733    SPC97079.1    OIVN01004379    SPD17029.1    OIVN01003558    SPD12118.1    OIVN01004603    SPD18338.1    OIVN01002256    SPD02034.1    OIVN01005059    SPD20680.1    OIVN01005591    SPD23209.1    NWSH01002292    PCG68656.1    OIVN01001789    SPC97674.1    LBMM01012645    KMQ86082.1    ASHM01002084    PNY07765.1    OIVN01002904    SPD07378.1    OIVN01004879    SPD19723.1    OIVN01006429    SPD32977.1    OIVN01006120    SPD25513.1    OIVN01000106    SPC74385.1    OIVN01004867    SPD19656.1    GEHC01000879    JAV46766.1    OIVN01001656    SPC96275.1    CM003605    KYP69858.1    LBMM01012492    KMQ86193.1    AAZX01015857    AAZX01019482    OIVN01001669    SPC96464.1    GAMC01006169    JAC00387.1    OIVN01002680    SPD05612.1   
Pfam
PF13976   gag_pre-integrs        + More
PF07727   RVT_2
PF00665   rve
PF00098   zf-CCHC
PF13961   DUF4219
PF13855   LRR_8
PF03106   WRKY
PF00931   NB-ARC
PF18052   Rx_N
Interpro
IPR025724   GAG-pre-integrase_dom        + More
IPR036397   RNaseH_sf       
IPR012337   RNaseH-like_sf       
IPR013103   RVT_2       
IPR001584   Integrase_cat-core       
IPR039537   Retrotran_Ty1/copia-like       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR025314   DUF4219       
IPR032675   LRR_dom_sf       
IPR036576   WRKY_dom_sf       
IPR001611   Leu-rich_rpt       
IPR003657   WRKY_dom       
IPR002182   NB-ARC       
IPR027417   P-loop_NTPase       
IPR041118   Rx_N       
SUPFAM
SSF53098   SSF53098        + More
SSF57756   SSF57756       
SSF118290   SSF118290       
SSF52540   SSF52540       
Gene 3D

Ontologies

Topology

Subcellular location
Nucleus  
Length:
315
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0113
Exp number, first 60 AAs:
0
Total prob of N-in:
0.10945
outside
1  -  315
 
 

Population Genetic Test Statistics

Pi
4.490763
Theta
30.839539
Tajima's D
-0.377636
CLR
4.830238
CSRT
0.269986500674966
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号