SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15253
Annotation
PREDICTED:_uncharacterized_protein_LOC106717563_[Papilio_machaon]
Location in the cell
Nuclear   Reliability : 4.251
 

Sequence

CDS
ATGGAAGAAATAAAAGACATGTTCTTGAGTTTGCAACAAGACATAAAACAACAAAAAGAAGATATGGTAAAGATGAAGGAAGACATCAAAAACATAATAGTTAACAGCCTTGCCGAGAAGTTAAGCAGCTTAGAACTTAAAAACGAGCTTTTAGAACAAAAAATTGAAGAACAAAATAGAAAGATGAACAACTTAGAAAGACAGTCTAGACGCAAAAACTTGGTCATGTTTGGTGTAGAAGAGCGCGAAAACTCATACCACGAACTTGAAGAAATGATAATCAGCATAATAAATACAAATTTTAAAGTATCCTGCGAAACTAACAGCATTGAAGCAGTACGTAGGTTGGGAAAAAAGGGTGAGAAGACCAGACCAGTAGTAATAACGTTCAACACATTAGGATTAAAACTAAAAATTCAGAAAGACAAATATTGTTTACAAAAAACCGCATACTACATAAAAGAAGACTATCCAATTGAAATCTTAAAAAAGCGCAAAGAGTTGCAAGCCCAGTTAGAGAGGGAAAAAGAAGCAGGAAATAGAGCAATTATAAGATATGACAAACTTATCATACTGAATAAAAAACATTCTCCCCGCAATCAACCAAACAAGAGATACCTTTCCGAATCCCCGGAGACACCTATGACTGCTAGCCAAGAAACTCAACACGTTGAAAAACAACCTTTGAAGAAAACCAAAGCGAGGAACATGAAAAGCTACATAACACAGACGCCCAAACTAGTATTCGCCCAGAAAGAAGCACCTCAAAACCAAACAAATACTTCCAAGGATAATGCAAAATAG
Protein
MEEIKDMFLSLQQDIKQQKEDMVKMKEDIKNIIVNSLAEKLSSLELKNELLEQKIEEQNRKMNNLERQSRRKNLVMFGVEERENSYHELEEMIISIINTNFKVSCETNSIEAVRRLGKKGEKTRPVVITFNTLGLKLKIQKDKYCLQKTAYYIKEDYPIEILKKRKELQAQLEREKEAGNRAIIRYDKLIILNKKHSPRNQPNKRYLSESPETPMTASQETQHVEKQPLKKTKARNMKSYITQTPKLVFAQKEAPQNQTNTSKDNAK

Summary

Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
Interpro
IPR005135   Endo/exonuclease/phosphatase        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR000477   RT_dom       
IPR004244   Transposase_22       
SUPFAM
SSF56219   SSF56219       
Gene 3D

Ontologies

Topology

Length:
267
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00017
Exp number, first 60 AAs:
0
Total prob of N-in:
0.01960
outside
1  -  267
 
 

Population Genetic Test Statistics

Pi
237.062293
Theta
158.912989
Tajima's D
2.439356
CLR
154.021583
CSRT
0.941502924853757
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号