SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15187
Pre Gene Modal
BGIBMGA013019
Annotation
PREDICTED:_uncharacterized_protein_LOC105842057_[Bombyx_mori]
Location in the cell
Nuclear   Reliability : 4.285
 

Sequence

CDS
ATGTCAACACATGAGTCATCGTCACAAATCATAGAAACAACTTCTAAGGAACTAATGCAATACAAGGACAGGAGCAATTTAAATGAACAAAACAACGATGGTTCAGAAGATTTCACCACAATGGCAGCCCTCAATGAATTAACGACAATGCCAACAGACGTAGAACTTTTGCTAAATGAACCAGAACTGTCAACGCATGAACCTCAATCCAAAGACACTGGCACTTCTAAAACAAACACGATGATTGATGATTATTCAGGAACCTCAGGACACCTAAAACCTCTGAACGTTGAACTTCAGCATCAGGGGGTTGAGGAATTATCTTTGTCATCCTGTATAAATCTTACATCGACAAACGATCCAATACCAGAAGCTGTACAAATGGTTGAGGTTATTTCTGAGTGTGAAAAAGAAAACCAAACACCAATATACGTAATACCTATTCCATCCACTAGTCGTCAAAGTTTAGAGCTGATTGGAGAAAAATGGGTACTAGTGGATGACATGCCAACCGAAGTCCCTTCAAAGAGTCCAATAAAGAAACAAAATATAAAAGATTTTTTAAAGTTACCAAAGACTCCAATTAAAACACAAAAAGCTGGTATAGAACGTCGCTCTTTTGTTTTAACGAGTAAAGATTGGGAAGCTGTAGAACTAGAAAAACAACAAAAAAAGATGAAAGAGATACAAGAAAAGGAGAACAAACGAATAGCAAGACTAGAAAAAGCCAAAGAGAAACGCTTACTCAAGGAAACAAAACAAGCTGAAACTATAAATAAAAAGAACAAAGCTAAAAATTTAAATTTAATTAAGAAAAGTAAGCCAAATTCTGATAGTATCAAATCAAAAATTGTTATTCAATCAAATGTTTTAATTAAGCCTGCAAATAGAATCTCAAGTGATATTAAAGAAAAAAGAGAATATACAAAAGAAATTAAAAAAGGACCTATGAACGAAGTTAAACCTGCAGATATTACTGCCCTGAAGGAAATAAAAAACAGGCCAATTTTAGATGCAGTTGAAGCTGCAAATGAAAGACTCTTTAAAGAATCGGAACAAGTACAGATGGTAAAAAAAGAATTAAAGAAAGGACCAATTTTAGATGAACTTAAACCTCCGAAAATAACTTTTCGAGATTCAAGGGAAACCGGAAAAGATAAGAAGATAAAAATTAAAGTAAATAGATTGAGACCAATGACAGATGAAGAATTGTTAAAAATGTTGGAAGATGATTAG
Protein
MSTHESSSQIIETTSKELMQYKDRSNLNEQNNDGSEDFTTMAALNELTTMPTDVELLLNEPELSTHEPQSKDTGTSKTNTMIDDYSGTSGHLKPLNVELQHQGVEELSLSSCINLTSTNDPIPEAVQMVEVISECEKENQTPIYVIPIPSTSRQSLELIGEKWVLVDDMPTEVPSKSPIKKQNIKDFLKLPKTPIKTQKAGIERRSFVLTSKDWEAVELEKQQKKMKEIQEKENKRIARLEKAKEKRLLKETKQAETINKKNKAKNLNLIKKSKPNSDSIKSKIVIQSNVLIKPANRISSDIKEKREYTKEIKKGPMNEVKPADITALKEIKNRPILDAVEAANERLFKESEQVQMVKKELKKGPILDELKPPKITFRDSRETGKDKKIKIKVNRLRPMTDEELLKMLEDD

Summary

Pfam
PF03184   DDE_1        + More
PF05225   HTH_psq
Interpro
IPR004875   DDE_SF_endonuclease_dom        + More
IPR006600   HTH_CenpB_DNA-bd_dom       
IPR009057   Homeobox-like_sf       
IPR007889   HTH_Psq       
SUPFAM
SSF46689   SSF46689       
ProteinModelPortal

Ontologies

Topology

Length:
411
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0
Exp number, first 60 AAs:
0
Total prob of N-in:
0.00757
outside
1  -  411
 
 

Population Genetic Test Statistics

Pi
395.729316
Theta
196.23495
Tajima's D
3.14557
CLR
1.092569
CSRT
0.984150792460377
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号