SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15122
Annotation
integrase_core_domain_protein_[Lasius_niger]
Location in the cell
Cytoplasmic   Reliability : 1.252 Nuclear   Reliability : 1.54
 

Sequence

CDS
ATGATGACATTTGATGTTAAGACTGCATTTTTATATGGAGAGCTGGAAGAAAATGTGTATATGAATATACCGGATGGTTATGAAAAACAACCTGGGAAAGTTTGTCGATTAAAGAAATCCTTATATGGACTAAAACAAGCTCCTATTACATGGAACAAAAGATTTACAAAAGCAATGTTAAAACTTGGTTTAAAAGCTACTAAAACAGATCAGTGTGTATTTACAAATGAAGATAATACAATAATAATAGCAATCTATGTAGATGATGGACTTGCTTTGGCTAAAGAAAAGCAAACATTAAAAAACATTTTAAACTGTCTAGAAAAGGAATTTGAAATAAAAGTATACAATGATCCTACTACTTTTATTGGATTTGAAGTCAAGAAGACTGAGAAAGGTATAACACTGAAACAAGAAAGCTACATTGGAAACTTATTAGAGAAATTCAGTATGGAAGATTCTAAACCTGTTAAGACACCCTGTAATACAGAAAATAAAACAGAAACGCAAAACACAGATTCTATAAATTTTCCATATAGAGAACTGATTGGAGGACTTCTATATGTATCTACAAGAACAAGGCCAGACATAAGTCAAGCTGTAAATGAAGCGAGCAGAAAAATAGAAAACCCTACGAAAGATGATGTGATAGCTGCAAAGAAAATACTAAAATATTTAAATGGAACAAGACAGAAAGGAATCATGTACAAGAAAGGAGGAGATATTTCAAAACTAAATGCATACTGTGATGCAGACTATGCCAATTGTGTCAAGACTAGACGCAGTACAACCGGATTTGTGATAATGTTAGCAGAAGGACCTGTGTCTTGGTGTTCAAAACGACAACCAATCGTTGCATTATCATCAACTGAAGCAGAGTATATTGCAGCAGCTGATTGCTGTAAGGAATGCTTATATTTAAAGTCATTTTTAAAGGAGTTGATTGGTTCTGAAGTTGAAATTACATTGAATGTTGATAACCAAAGCGCTATTCAGCTGATCAAAACAGGAGAAGGTGTTAGTGGGTACATCCCTATTAAGAAGTGTGAGCTGTAA
Protein
MMTFDVKTAFLYGELEENVYMNIPDGYEKQPGKVCRLKKSLYGLKQAPITWNKRFTKAMLKLGLKATKTDQCVFTNEDNTIIIAIYVDDGLALAKEKQTLKNILNCLEKEFEIKVYNDPTTFIGFEVKKTEKGITLKQESYIGNLLEKFSMEDSKPVKTPCNTENKTETQNTDSINFPYRELIGGLLYVSTRTRPDISQAVNEASRKIENPTKDDVIAAKKILKYLNGTRQKGIMYKKGGDISKLNAYCDADYANCVKTRRSTTGFVIMLAEGPVSWCSKRQPIVALSSTEAEYIAAADCCKECLYLKSFLKELIGSEVEITLNVDNQSAIQLIKTGEGVSGYIPIKKCEL

Summary

EMBL
GECZ01017843    JAS51926.1    LBMM01009639    KMQ87973.1    GBHO01040573    JAG03031.1    + More
GBHO01040574    JAG03030.1    GBHO01028636    GBHO01028635    JAG14968.1    JAG14969.1    GBHO01035865    JAG07739.1    GBHO01006096    JAG37508.1    GDHC01005053    JAQ13576.1    GBHO01024362    JAG19242.1    GBHO01016409    JAG27195.1    GEDC01029908    JAS07390.1    GBHO01035869    GBHO01006095    JAG07735.1    JAG37509.1    GBHO01031779    JAG11825.1    GBHO01003079    JAG40525.1    GBHO01012744    JAG30860.1    GECL01003258    JAP02866.1    GDAI01002967    JAI14636.1    KQ971338    KYB28117.1    GDHC01010945    JAQ07684.1    GEZM01048830    JAV76370.1    LBMM01012772    KMQ86003.1    ABLF02026843    ABLF02042027    AAZX01004557    NCKU01004452    RWS05910.1    LBMM01012536    KMQ86167.1    GEZM01099107    JAV53485.1    AAZX01004151    GEZM01078128    GEZM01078127    JAV63002.1    LBMM01006309    KMQ90715.1    GEZM01017327    JAV90764.1    LBMM01003976    KMQ92933.1    ABLF02043571    ABLF02045585    ABLF02057174    ABLF02063637    ABLF02063640    GGMR01009345    MBY21964.1    KQ459875    KPJ19636.1    OIVN01001707    SPC96839.1    GDHC01004875    JAQ13754.1    GBHO01037840    JAG05764.1    OIVN01004910    SPD19931.1    LBMM01011832    KMQ86599.1    GEZM01017329    JAV90762.1    GEZM01017328    JAV90763.1    OIVN01002268    SPD02135.1    LBMM01020254    KMQ83327.1    JXUM01170260    KQ578575    KXJ67779.1    GEZM01002084    JAV97376.1    DS568115    OIVN01001729    SPC97049.1    OIVN01004563    SPD18125.1    LBMM01008978    KMQ88491.1    OIVN01003464    SPD11432.1    AAZX01023229    OIVN01001052    SPC89229.1    KL367655    KFD60665.1    JYDM01000512    KRZ81798.1    OIVN01003897    SPD14257.1    OIVN01001196    SPC91020.1    OIVN01004420    SPD17230.1    OIVN01001091    SPC89740.1    NEVH01013628    PNF28358.1    OIVN01000147    SPC75222.1    OIVN01000945    SPC87766.1    OIVN01005024    SPD20514.1    OIVN01006160    SPD26619.1    OIVN01000183    SPC75833.1    OIVN01006432    SPD33020.1    OIVN01002622    SPD05126.1    OIVN01001890    SPC98658.1    OIVN01001309    SPC92453.1    OIVN01001022    SPC88819.1    OIVN01001520    SPC94877.1    GDIP01229956    JAI93445.1    OIVN01000116    SPC74628.1    OIVN01002904    SPD07378.1    OIVN01000557    SPC82046.1    LBMM01012696    KMQ86052.1    GBXI01011094    JAD03198.1    KL367644    KFD60897.1    OIVN01002680    SPD05612.1    OIVN01004379    SPD17029.1    OIVN01001669    SPC96464.1    OIVN01000681    SPC84018.1    OIVN01000609    SPC82932.1    GDIP01041293    JAM62422.1    OIVN01005657    SPD23465.1    OIVN01006233    SPD28466.1    OIVN01003569    SPD12194.1    OIVN01006372    SPD31671.1    OIVN01004603    SPD18338.1    OIVN01005312    SPD21871.1    OIVN01004867    SPD19656.1    OIVN01001666    SPC96375.1    OIVN01000036    SPC73022.1    GDIP01156971    JAJ66431.1    OIVN01001762    SPC97349.1    OIVN01005059    SPD20680.1    OIVN01000313    SPC78111.1    KN818358    KIL57786.1   
Pfam
PF07727   RVT_2        + More
PF00665   rve
PF13976   gag_pre-integrs
PF00098   zf-CCHC
PF13961   DUF4219
Interpro
IPR013103   RVT_2        + More
IPR039537   Retrotran_Ty1/copia-like       
IPR036397   RNaseH_sf       
IPR012337   RNaseH-like_sf       
IPR001584   Integrase_cat-core       
IPR025724   GAG-pre-integrase_dom       
IPR036875   Znf_CCHC_sf       
IPR001878   Znf_CCHC       
IPR025314   DUF4219       
SUPFAM
SSF53098   SSF53098        + More
SSF57756   SSF57756       
Gene 3D

Ontologies

Topology

Length:
351
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00096
Exp number, first 60 AAs:
0
Total prob of N-in:
0.01570
outside
1  -  351
 
 

Population Genetic Test Statistics

Pi
192.572698
Theta
144.747052
Tajima's D
1.160012
CLR
0
CSRT
0.702714864256787
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号