SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15113  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA004905
Annotation
hypothetical_protein_KGM_16288_[Danaus_plexippus]
Location in the cell
Cytoplasmic   Reliability : 1.146 Mitochondrial   Reliability : 1.425
 

Sequence

CDS
ATGACTTATGCACATACGTACAAGGCTCACTCTACTTTCAGGTACAAACTAAGACCTGAAGTAAATTTGGAAGCCGTCGCAGAGGCACTACCCGACAAGTGCACCGGCGCTGACTTACTGCAGGTTGTCTCTACTGCACGGTCAGCGGCCGTGAGAGCACTCGTTGCTAAGCTACACAATGGAACGTTAAAGGAAAGCGAACTGAGTCCCGACTCCATCGTTATAGGGGTAAGTGAACTATGGGAGGGCGTTGTATCATTCCGGCCCTCGGTCACAGACGATGAACTGTCGCATTACGAAGCGATGGAGTCACAAATGTAA
Protein
MTYAHTYKAHSTFRYKLRPEVNLEAVAEALPDKCTGADLLQVVSTARSAAVRALVAKLHNGTLKESELSPDSIVIGVSELWEGVVSFRPSVTDDELSHYEAMESQM

Summary

Similarity
Belongs to the AAA ATPase family.
Pfam
PF00004   AAA        + More
PF03297   Ribosomal_S25
PF17862   AAA_lid_3
PF09336   Vps4_C
Interpro
IPR003593   AAA+_ATPase        + More
IPR027417   P-loop_NTPase       
IPR003959   ATPase_AAA_core       
IPR004977   Ribosomal_S25       
IPR003960   ATPase_AAA_CS       
IPR041569   AAA_lid_3       
IPR015415   Vps4_C       
SUPFAM
SSF52540   SSF52540       

Ontologies

Topology

Length:
106
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0023
Exp number, first 60 AAs:
0.00154
Total prob of N-in:
0.67222
inside
1  -  106
 
 

Population Genetic Test Statistics

Pi
371.042519
Theta
210.184601
Tajima's D
2.337345
CLR
0
CSRT
0.929303534823259
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号