SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO15105
Annotation
PREDICTED:_uncharacterized_protein_LOC105389553_[Plutella_xylostella]
Location in the cell
Mitochondrial   Reliability : 1.008 Nuclear   Reliability : 1.595
 

Sequence

CDS
ATGCATCGCGAGAACGGCCAAGCCGAACGCTACTGCAGAACCGTTCTTAATTTACTACGAGTCGAAGTTGGTAGCAAAGGCTCCCAATGGTCTGATGTGCTGTGGAAAGCACAGCTTACTTTAAACATCACGAAGCAGACGACCACGCAGGCTTCACCACTTCAGCTCCTTATTGGTATAGAGGCAGCTACTCCAGTCATTAGAGATCTGGTGCGCGATGTTGCGTTAGACGCCAATTCTAACCGTGAAGCTTTACTAACCCTCAGTCGACAGAAAGCATCCGAATTACTATTGGACAATCAACGGCGACAAGACGAACAGGTCAACGAACGTCGGCGCCAGCCCACAACGTTTGCTGTGGGTGACTTCGTGTTCGTCAACAAGGCAACACAGTCAACGGGCAAACTCGACTCCGGGATGCGCGGCCCTTACAAGGTCTTGCGCACGCTTCCACATCACCGTTACGAGCTGGAGCTTCTCGCCGGTTCCTACGGCAAAAAGACACAAGCGGCCGCCCAATGTATGGTGTTGTGGCGCGGCGAGTGGACCCCGGAGACATGCAGCGCTTTCTTTGAAACTGAGGGTGAACTTATTGATGCGACTTCTGACGTAGCTGGAAGAGGCCTTCCTCTATTGAGAGATGAGGCGGTCGAGGACGCCTCGCCATCAGGAACGGCCGTATTACCGAGTCCAGGCAACCCCCGACCGGAAACACTATAA
Protein
MHRENGQAERYCRTVLNLLRVEVGSKGSQWSDVLWKAQLTLNITKQTTTQASPLQLLIGIEAATPVIRDLVRDVALDANSNREALLTLSRQKASELLLDNQRRQDEQVNERRRQPTTFAVGDFVFVNKATQSTGKLDSGMRGPYKVLRTLPHHRYELELLAGSYGKKTQAAAQCMVLWRGEWTPETCSAFFETEGELIDATSDVAGRGLPLLRDEAVEDASPSGTAVLPSPGNPRPETL

Summary

EMBL
RSAL01000035    RVE51343.1    KQ460855    KPJ11840.1    GBHO01030786    JAG12818.1    + More
GDHC01004980    JAQ13649.1    GBXI01005730    JAD08562.1    GBXI01010986    JAD03306.1    GBXI01004632    JAD09660.1    ATLV01014752    KE524984    KFB39514.1    NWSH01001093    PCG72660.1    LBMM01011782    KMQ86633.1    LBMM01011790    KMQ86624.1    GBYB01008369    JAG78136.1    GDHF01030992    JAI21322.1    LBMM01008296    KMQ88999.1    GBHO01037839    JAG05765.1    GAKP01001563    JAC57389.1    JXUM01072364    KQ562717    KXJ75259.1    LBMM01008871    KMQ88569.1    GAKP01016237    JAC42715.1    GAKP01000974    JAC57978.1    LBMM01019746    KMQ83464.1    LSSK01001748    LSSK01001018    OMH78870.1    OMH80988.1    GAMC01020207    JAB86348.1    NWSH01002797    PCG67520.1    GAKP01016235    JAC42717.1    GAMC01007326    JAB99229.1    LBMM01019745    KMQ83465.1    LBMM01005919    KMQ91095.1    KMQ91096.1    LBMM01004258    KMQ92653.1    GAMC01015907    JAB90648.1    GGLE01007069    MBY11195.1    LRGB01001727    KZS10738.1    GAKP01004347    JAC54605.1    GEZM01005427    JAV96179.1    KQ483848    KYP40258.1    ABLF02004526    ABLF02054969    GDKW01003992    JAI52603.1    GBRD01014907    JAG50919.1    LSSK01000685    OMH82338.1    GALX01004559    JAB63907.1    GAMC01016175    JAB90380.1    KZ503099    PKU68398.1    GAKP01019383    JAC39569.1    KQ971321    EEZ99497.2    HG807638    CDW60978.1    LBMM01010976    KMQ87102.1    GAKP01019384    JAC39568.1   
Pfam
PF17921   Integrase_H2C2        + More
PF00665   rve
PF00078   RVT_1
PF00077   RVP
PF17919   RT_RNaseH_2
PF02037   SAP
PF00098   zf-CCHC
PF17917   RT_RNaseH
PF12384   Peptidase_A2B
PF03732   Retrotrans_gag
Interpro
IPR041588   Integrase_H2C2        + More
IPR036397   RNaseH_sf       
IPR012337   RNaseH-like_sf       
IPR001584   Integrase_cat-core       
IPR001878   Znf_CCHC       
IPR001969   Aspartic_peptidase_AS       
IPR001995   Peptidase_A2_cat       
IPR041577   RT_RNaseH_2       
IPR000477   RT_dom       
IPR018061   Retropepsins       
IPR021109   Peptidase_aspartic_dom_sf       
IPR036875   Znf_CCHC_sf       
IPR036361   SAP_dom_sf       
IPR003034   SAP_dom       
IPR041373   RT_RNaseH       
IPR024650   Peptidase_A2B       
IPR005162   Retrotrans_gag_dom       
SUPFAM
SSF53098   SSF53098        + More
SSF50630   SSF50630       
SSF57756   SSF57756       
SSF68906   SSF68906       
Gene 3D
PDB
3DLR     E-value=0.0183676,     Score=86

Ontologies

Topology

Length:
239
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.0039
Exp number, first 60 AAs:
0.00177
Total prob of N-in:
0.16688
outside
1  -  239
 
 

Population Genetic Test Statistics

Pi
3.301531
Theta
19.260105
Tajima's D
-0.507335
CLR
4213.074564
CSRT
0.24108794560272
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号