SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14952
Annotation
PREDICTED:_uncharacterized_protein_LOC105842356_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.336
 

Sequence

CDS
ATGCAGTGTGAAACCAACCTAGCCCTGAGTTCGTCGAGGCGATTGGCCAACCCCACGTGGGGGCTACGGACCGTCGAGGCGGTTTACCCGGTCTTTGATGACTGGGTGAATCGTGGCGAGGGACGTCTCACCTTTCGTCTGGTGCAGGTGCTGACCGGGCACGGATGCTTCGGGAAGTACCTGCGCCGGATAGGGGCTGAGCCGACGACGAGGTGTCACCATTGTGGACACGACCTGGACACGGCGGAGCATACGCTCGCTGTCTGCCCCGCTTGGGAGGTGCAGCGCCGTGTCCTGGTCGCAAAGATAGGACCTGACTTGTCGCTGCCTGGCGTCGTGGCGTCGATGCTTGGCAGCGATGAGTCATGGAAGGCTATGCTCGACTTCTGCGAGTGCACCATCTCGCAGAAGGAGGCGGCGGGGCGAGTGAGGGAAAGCTCTCCTCACTACGCAGAAACCCGCCGCCGCCGAGCAGGGGGTCGGGACCGGGGTCGTATCCGTGACCTGGCCCCCTAA
Protein
MQCETNLALSSSRRLANPTWGLRTVEAVYPVFDDWVNRGEGRLTFRLVQVLTGHGCFGKYLRRIGAEPTTRCHHCGHDLDTAEHTLAVCPAWEVQRRVLVAKIGPDLSLPGVVASMLGSDESWKAMLDFCECTISQKEAAGRVRESSPHYAETRRRRAGGRDRGRIRDLAP

Summary

Cofactor
FAD
Similarity
Belongs to the FBPase class 1 family.
Belongs to the GMC oxidoreductase family.
EMBL
AB090825    BAC57926.1    AB126050    BAD86650.1    LBMM01009501    KMQ88083.1    + More
LBMM01016102    KMQ84557.1    KZ149922    PZC77701.1    QOIP01000014    RLU15083.1    LBMM01005707    KMQ91279.1    KZ149896    PZC78733.1    QOIP01000009    RLU18544.1    KZ150386    PZC71062.1    AB078935    BAC06462.1    LBMM01012957    LBMM01012956    KMQ85900.1    KMQ85901.1    ODYU01003322    SOQ41921.1    KZ150308    PZC71477.1    LBMM01012027    KMQ86470.1    KZ149950    PZC76665.1    AB078931    BAC06456.1    AB078930    BAC06454.1    KZ149918    PZC77857.1    LBMM01006538    KMQ90523.1    AB078929    BAC06452.1    RSAL01000006    RVE54258.1    QOIP01000004    RLU23632.1    ODYU01006757    SOQ48893.1    QOIP01000060    RLU14687.1    ODYU01004308    SOQ44039.1    LBMM01003679    KMQ93242.1    RSAL01003504    RVE40273.1    LBMM01006022    KMQ91008.1    LBMM01001564    KMQ96079.1    PZC77700.1    LBMM01006909    KMQ90209.1    ODYU01009945    SOQ54696.1    RSAL01000481    RVE41577.1    GL450953    EFN80213.1    RSAL01000109    RVE47213.1    RSAL01000014    RVE53298.1    ODYU01008140    SOQ51495.1    ODYU01005282    SOQ45985.1    LBMM01006996    KMQ90129.1    ODYU01006342    SOQ48109.1    LBMM01004272    KMQ92618.1    LBMM01006954    KMQ90166.1    ODYU01005115    SOQ45661.1    QOIP01000002    RLU25407.1    ODYU01004693    SOQ44845.1    ABLF02006132    QOIP01000012    RLU16027.1    QOIP01000007    RLU20280.1    LBMM01019838    KMQ83439.1    QOIP01000013    RLU15211.1    LBMM01019839    KMQ83438.1    LBMM01005634    KMQ91349.1    LBMM01006657    KMQ90417.1    QOIP01000003    RLU25053.1    LBMM01003452    KMQ93523.1    ODYU01010680    SOQ55954.1    QOIP01000031    RLU14697.1    ODYU01004136    SOQ43692.1    QOIP01000010    RLU18098.1    GGMR01011974    MBY24593.1    LBMM01007036    KMQ90099.1    ODYU01005460    SOQ46344.1    LBMM01004697    KMQ92167.1    LBMM01006671    KMQ90407.1   
Pfam
PF14529   Exo_endo_phos_2        + More
PF00078   RVT_1
PF01553   Acyltransferase
PF00316   FBPase
PF01421   Reprolysin
PF07776   zf-AD
PF00096   zf-C2H2
PF00732   GMC_oxred_N
PF00650   CRAL_TRIO
PF00027   cNMP_binding
Interpro
IPR000477   RT_dom        + More
IPR036691   Endo/exonu/phosph_ase_sf       
IPR005135   Endo/exonuclease/phosphatase       
IPR002123   Plipid/glycerol_acylTrfase       
IPR033391   FBPase_N       
IPR000146   FBPase_class-1       
IPR028343   FBPtase       
IPR024079   MetalloPept_cat_dom_sf       
IPR001590   Peptidase_M12B       
IPR012934   Znf_AD       
IPR013087   Znf_C2H2_type       
IPR036236   Znf_C2H2_sf       
IPR036188   FAD/NAD-bd_sf       
IPR012132   GMC_OxRdtase       
IPR000172   GMC_OxRdtase_N       
IPR001878   Znf_CCHC       
IPR036875   Znf_CCHC_sf       
IPR001251   CRAL-TRIO_dom       
IPR036865   CRAL-TRIO_dom_sf       
IPR036273   CRAL/TRIO_N_dom_sf       
IPR006759   Glyco_transf_54       
IPR012337   RNaseH-like_sf       
IPR000961   AGC-kinase_C       
IPR018488   cNMP-bd_CS       
IPR000595   cNMP-bd_dom       
IPR017441   Protein_kinase_ATP_BS       
IPR011009   Kinase-like_dom_sf       
IPR018490   cNMP-bd-like       
IPR014710   RmlC-like_jellyroll       
SUPFAM
SSF56219   SSF56219        + More
SSF57667   SSF57667       
SSF51905   SSF51905       
SSF57756   SSF57756       
SSF52087   SSF52087       
SSF46938   SSF46938       
SSF53098   SSF53098       
SSF51206   SSF51206       
SSF56112   SSF56112       

Ontologies

Topology

Length:
171
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.01804
Exp number, first 60 AAs:
0.00826
Total prob of N-in:
0.11095
outside
1  -  171
 
 

Population Genetic Test Statistics

Pi
5.247018
Theta
14.616487
Tajima's D
-1.670586
CLR
60.809135
CSRT
0.0410979451027449
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号