SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14941
Annotation
endonuclease_and_reverse_transcriptase-like_protein_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 2.138
 

Sequence

CDS
ATGACCATTAACGCTGGCGTTCCACAAGGTTCGGTGCTCTCCCCCACGCTTTTCATCCTGTATATCAATGACATGCTGTCTATTGATGGCATGCATTGCTATGCGGATGACAGCACGGGGGATGCGCGATATATCGGCCATCAGAGTCTCTCTCGGAGCGCGGTGCAAGAGAGACGATCAAAACTTGTGTCTGAAGTGGAGAACTCTCTGGGGCGAGTCTCCGAATGGGGTGAATTGAACTTGGTTCAATTCAACCCGATAAAGACACAAGTTTGCGCGTTCACTGCGAAGAAGGACCCCTTTGTCATGGCGCCGCAATTCCAAGGAGTATCCCTGCAACCTTCCGAGAGTATCGGGATACTTGGGGTCGACATTTCGAGCGATGTCCAGTTTCGGAGTCATTTGGAAGGCAAAGCCAAGTTGGCGTCCAAAATGCTGGGAGTCCTCAACAGAGCAAAGCGGTACTTCACGCCTGGACAAAGACTTTTGCTTTATAAAGCACAAGTCCGGCCTCGCGTGGAGTACTGCTCCCATCTCTGGGCCGGGGCTCCCAAATACCAGCTTCTTCCATTTGACTCCATACAGAAGAGGGCCGTTCGGATTGTCGATAATCCCATTCTCACGGATCGTTTGGAGCCTCTGGGTCTGCGGAGGGACTTCGGTTCCCTCTGTATTCTGTATCGTATGTTCCATGGGGAGTGCTCTGAGGAATTGTTCGAGATGATACCGGCATCTCGTTTTTACCATCGCACCGCCCGCCACCGGAGTAGAGTTCATCCATACTACCTGGAGCCACTGCGGTCATCCACAGTGCGTTTCCAGAGGTCTTTTTTGCCACGTACCATCCGGCTATGGAATGAGCTCCCCTCCACGGTGTTTCCCGAGCGCTATGACATGTCCTTCTTCAAACGAGGCTTGTGGAGAGTATTAAGCGGTAGGCAGCGGCTTGGCTCTGCCCCTGGCATTGCTGAAGTCCATGGGCGACGGTAA
Protein
MTINAGVPQGSVLSPTLFILYINDMLSIDGMHCYADDSTGDARYIGHQSLSRSAVQERRSKLVSEVENSLGRVSEWGELNLVQFNPIKTQVCAFTAKKDPFVMAPQFQGVSLQPSESIGILGVDISSDVQFRSHLEGKAKLASKMLGVLNRAKRYFTPGQRLLLYKAQVRPRVEYCSHLWAGAPKYQLLPFDSIQKRAVRIVDNPILTDRLEPLGLRRDFGSLCILYRMFHGECSEELFEMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGLWRVLSGRQRLGSAPGIAEVHGRR

Summary

EMBL
AY359886    AAQ57129.1    AB126052    BAD86652.1    RSAL01002067    RVE40593.1    + More
RSAL01000487    RVE41561.1    RSAL01000422    RVE41792.1    RSAL01000002    RVE54942.1    RSAL01003136    RVE40332.1    RSAL01000090    RVE48098.1    RVE55041.1    RVE55094.1    ODYU01002162    SOQ39302.1    RSAL01000164    RVE45343.1    GDRN01105059    JAI57791.1    DPOC01000269    HCX22453.1    AMCI01002135    EJX03495.1    HAAD01001474    CDG67706.1    LWDP01000391    ORD92879.1    RSAL01000193    RVE44603.1    GFAC01000919    JAT98269.1    GEFM01002394    JAP73402.1    GEGO01001118    JAR94286.1    GEFM01002324    JAP73472.1    GBIH01002577    JAC92133.1    GFAA01002514    JAU00921.1    GFAA01002657    JAU00778.1    GFAC01005646    JAT93542.1    GFAA01002479    JAU00956.1    GEGO01004630    JAR90774.1    GEGO01003312    JAR92092.1    GEFM01006417    JAP69379.1    GEGO01004433    JAR90971.1    GDRN01111277    JAI56804.1    GEFM01002419    JAP73377.1    GEGO01002473    JAR92931.1    GEFM01006421    JAP69375.1    GFAC01005665    JAT93523.1    GEFM01005882    JAP69914.1    FLMD02000154    SCV66010.1    MRZV01000639    PIK46517.1    GDRN01111334    JAI56796.1    GEGO01003518    JAR91886.1    NSIT01000412    PJE77717.1    LSMT01000297    PFX20951.1    FLMD02000280    SCV66640.1    NSIT01000218    PJE78268.1    GEGO01003111    JAR92293.1    GEGO01004295    JAR91109.1    NSIT01000271    PJE78081.1    GEGO01003794    JAR91610.1    GFAA01000066    JAU03369.1    GEGO01007187    JAR88217.1    GADI01001229    JAA72579.1    GFAA01002385    JAU01050.1    GFAA01003161    JAU00274.1    GFAC01000861    JAT98327.1    GFAC01005670    JAT93518.1    NSIT01000239    PJE78188.1    LSMT01000588    PFX15986.1    KZ505886    PKU43598.1    NSIT01000164    PJE78524.1    GFAA01002726    JAU00709.1    GEGO01007438    JAR87966.1    GEGO01002025    JAR93379.1    GEGO01003427    JAR91977.1    GEFM01006250    JAP69546.1    GEGO01005479    JAR89925.1    GEGO01004248    JAR91156.1    GEGO01004132    JAR91272.1    AAGJ04095885    GEGO01003895    JAR91509.1    GEFM01005909    JAP69887.1    GEGO01002794    JAR92610.1    GANP01010944    JAB73524.1    GEGO01004857    JAR90547.1    GEGO01004056    JAR91348.1    AAGJ04171490    GEGO01004752    JAR90652.1    NSIT01000225    PJE78229.1    PSZC01000087    PPJ25136.1    GFAC01007905    JAT91283.1   
Pfam
PF00078   RVT_1        + More
PF14529   Exo_endo_phos_2
PF01585   G-patch
PF04939   RRS1
PF01873   eIF-5_eIF-2B
PF08159   NUC153
PF00458   WHEP-TRS
PF03372   Exo_endo_phos
PF01425   Amidase
Interpro
IPR000477   RT_dom        + More
IPR005135   Endo/exonuclease/phosphatase       
IPR036691   Endo/exonu/phosph_ase_sf       
IPR012677   Nucleotide-bd_a/b_plait_sf       
IPR000504   RRM_dom       
IPR034653   SPF45_RRM       
IPR003954   RRM_dom_euk       
IPR000467   G_patch_dom       
IPR040052   RBM17       
IPR035979   RBD_domain_sf       
IPR007023   Ribosom_reg       
IPR016190   Transl_init_fac_IF2/IF5_Zn-bd       
IPR002735   Transl_init_fac_IF2/IF5       
IPR016189   Transl_init_fac_IF2/IF5_N       
IPR036322   WD40_repeat_dom_sf       
IPR040382   NOL10/Enp2       
IPR012580   NUC153       
IPR001680   WD40_repeat       
IPR000738   WHEP-TRS_dom       
IPR009068   S15_NS1_RNA-bd       
IPR000120   Amidase       
IPR036928   AS_sf       
IPR023631   Amidase_dom       
SUPFAM
SSF56219   SSF56219        + More
SSF54928   SSF54928       
SSF75689   SSF75689       
SSF100966   SSF100966       
SSF50978   SSF50978       
SSF47060   SSF47060       
SSF75304   SSF75304       
Gene 3D

Ontologies

Topology

Length:
329
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.7135
Exp number, first 60 AAs:
0.71344
Total prob of N-in:
0.04468
outside
1  -  329
 
 

Population Genetic Test Statistics

Pi
8.337027
Theta
19.66019
Tajima's D
-1.544306
CLR
35.144614
CSRT
0.0548972551372431
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号