SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14918  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA000774
Annotation
carboxyl/cholinesterase_6_precursor_[Bombyx_mori]
Location in the cell
PlasmaMembrane   Reliability : 2.134
 

Sequence

CDS
ATGATAAGACTGGGTCTGGTGATGCTGTTCCTAATACCTGGAACAGAACAGAATGTAATCAGTATAGCTCAGGGGAAGATACGGGGACGCGTCAGAGATGGTTACGTGACGTATGGCGGTATACCTTATGGATCTCTGATGCTTAAGGGGAGATTTAAGCAAGCCGGCATAGCTCCCGTTTGGCCTAACATACGAGAGTTCCACGAATCTCGCTGTTCAACAACTTCCGCCGCCGAGGAGTGTCTGCAGCTCGACGTCAACGTGCCCACGTCGGCTGCTCCAACGTGGCCTGTACTAGTCTGGGTCACAGGTTCAGACGGAAGTTATCACTCTGGACAACTGGTCAAGAAGGGAGTTATTGTAGTCATTGTGCGTCACAGGTTAGGCGCCCCTGGATTCTTATGCTACGAAAGAGATATACCAGGAAACGCAGGCGCAAAAGACGTTATAGCAGCATTACACTGGGTCAGAGACAACATAATTGCTTTCAAAGGAAACCCGGCAAGAGTTGTCGTCGCGGGCCAGGGTTTTGGAGCTGCCATGGTGGAAGCATTAACACTTACCCCAATGGCTGAAGGACTGTTCCACGGTGTTATATTGCAAAGCGGCAGCATATTAGCTCCGTGGGCTTTCAACTATGATGCCAAAGACAGGGCCAAAGTTATCGGAGAGCGTTTAGACAAAAAACGAGATTATGTCGATGTTTTTTTAAATGCCACAATGGAAGAATTATTTATTAAATCAAGTGAATCGAACACGCCATATTTCTCTTTTGGCCTTTGTCTGGAAGAACCACTGAAGAATGAGGAGCGGTTTTTCTTGGAGACGCCTTACGATTTGTTCGTGACAAAGAAGTCTAAATCTGTTCCAATGATAATCGGCTACAATAGTGATGAAGCGTATATATTCTCATCACTACTAAAGGAGTTTAAGGTTATTAATAAATTAACTAAAGATATTAGCTTTTTACTGCCATACGAGTTGCAATTTTTAAATAGTAGAGAAATGAATCAAGTTTCTCGACAAATCGAGGACATTTACTTCAGAAGAAATCGTACAATGACTGCTCTGCTGGCTTACCACAGGGACGTATACTTTTTAAGCCATGTTTATCGAAGTGCCAGTTATCACGCCGCGGTGTCATCCCTTGTCTACTTCTACACGTTTTCACACCTTGGAGAAGTCGGCGTTCAAAAAGAACCTGGAATCCAGAAAAGCGGAGCCGCTCATTCAGATGAACTTGCATATCTATTTTCTGGGCGAAATCTGGATAAAGAAGACGGCCTTGTCCAAGACCTTTTGGTACGATTTTGGGTCAACTTCGTGATACATTTAAATCCAACTCACCGACAACCACTTGACTGGGATCCAATGAATTACGAAAACCCTCGCCTACTCGATATAGGCGTTGAACCTAAGATGATCGACTACCCTTACGAGAAGACTTCAAAATTTTGGGAAGAAATTTATGACAATTCAGTTACCCTGATTTTAATTGGTTCAGCGATATATGCAGAGTCCTTCACTAAAAAATGTGATGTGCTGGTGAAGTTAGACTCGGGACCTGTGTGCGGGAGAGAGGAGAGCGCAAACAAAAATACCAAATACTTCAGTTTCCAGGGCATTCCGTATGCGAAGCCACCCGTAGGCGCCAGAAGATTTTCTGAACTGGAGCCACTTGAGCCATGGTCTGAACCGTTCTACGCTTACGAAGAAGGGCCGGCCTGTCCGTCGAGAGATATTACTTACGGCAGTATTACCGTCAAACGCAAAGGAATGAGTGAAAACTGTATTTATGCTAATGTATTTGTACCGGCGTCTGCGACTCTGAACAGCGATGAACTTTGCGAAGACAATTCACTGCCCATATTGGTGAATATCCACGGTGGTGGGTTCCAAACAGGATCTGGCAATAGAGATTTGCATGGACCGGAATTGTTGATGTTAAAAGATGTCATTGTAGTAAATTTTAATTACAGATTGGCCATTTTCGGATACTTGTCTCTTGCTTCTCATAAGATTCCTGGTAATAATGGACTGCGAGACATGGTGACGCTGCTAAAGTGGGTGCAGAGAAATGCAAAAGTATTCGGGGGAGACCCTAAGCGAGTGACAATACTCGGAGAAAGTGCTGGAGCAGCATCAGTACACCTTCTCATGTTGTCTCGGGCCTCCAAAGGACTATTCAACAAAGCTATTATAATGAGTGGTACCGCTATACCAAACTTCTATAGCTCGTCCCCAATATATGCCAAATACATCTCCGACATGTTTCTCGGAGAACTAGGTTTAAACTCTACCGAGTTAACGTCTGATGAAATTCATCAGACTTTAACTGAATTACCGTTAGATGATATTATGAGAGCCAATGACGTTGTGCAATACAGAGCGGGTTTAACTTCGTTCGTTCCGGTTGTAGAGAAAGAGGGTCATGATTATACCAGGATCATTGACGATGATCCGATTACTTTAATTAATCAAGGTGTGGGCAAGGACATTCCCTTACTAATGGGTTTCAATAAGGATGAAGGTGAATATTTCAAATGGATAATCACTATTTACAATATTGTGGACCGTTATAAAAGTAATCCGGCAGTTATTTTATCGCCAAGACTGGCGTACGAGTTGCCCCCACAAGAAGCTTCAGCCAAAGGAATATTCGTGGGGAAAAGATATTTTGACGGTGAGCCCACAGTGGATGGATTCGTAAAAAGCGTGACGGATATTTACTTTCAATATCCTATGATCAAACTGGCACAATGGAGAATACTTTTGAATTCGGCGCCGACATATTTTTACGAATTTTCGTATGAAAGCGACTTCAGCATTACAAAGAGAGCCAACTGGTTAAGCTACAAAGGAACTGCTCATGTCGAGGATCTGACGTACGTGTTCCACACTACCACGTTTCTCGGAAGTCAAGTGTCAGTGCCTCCTAAAACCAGAGATGACCAAATGAGGGATTGGATGTCTACTTTATTCAGTAACTACGTAAGATGCAATAATCCTACATGCAATAAGCGTGATGATCCTCGGTGGCCTCCCATTAACGAAGAAGAGTTAATGTTTCAAGTTATCAAAGAGCCCAATGTTTATAAGATGTCTTCATTACCAAAGCAGTTGGAGGACATGGTGGAATTCCATGACGGTGTAGACGATCAAGTCAGGATGCAGTCAGAAATCCTTAAGGAGCAAAAAAAGAAACATAGTATGTACCAGTAA
Protein
MIRLGLVMLFLIPGTEQNVISIAQGKIRGRVRDGYVTYGGIPYGSLMLKGRFKQAGIAPVWPNIREFHESRCSTTSAAEECLQLDVNVPTSAAPTWPVLVWVTGSDGSYHSGQLVKKGVIVVIVRHRLGAPGFLCYERDIPGNAGAKDVIAALHWVRDNIIAFKGNPARVVVAGQGFGAAMVEALTLTPMAEGLFHGVILQSGSILAPWAFNYDAKDRAKVIGERLDKKRDYVDVFLNATMEELFIKSSESNTPYFSFGLCLEEPLKNEERFFLETPYDLFVTKKSKSVPMIIGYNSDEAYIFSSLLKEFKVINKLTKDISFLLPYELQFLNSREMNQVSRQIEDIYFRRNRTMTALLAYHRDVYFLSHVYRSASYHAAVSSLVYFYTFSHLGEVGVQKEPGIQKSGAAHSDELAYLFSGRNLDKEDGLVQDLLVRFWVNFVIHLNPTHRQPLDWDPMNYENPRLLDIGVEPKMIDYPYEKTSKFWEEIYDNSVTLILIGSAIYAESFTKKCDVLVKLDSGPVCGREESANKNTKYFSFQGIPYAKPPVGARRFSELEPLEPWSEPFYAYEEGPACPSRDITYGSITVKRKGMSENCIYANVFVPASATLNSDELCEDNSLPILVNIHGGGFQTGSGNRDLHGPELLMLKDVIVVNFNYRLAIFGYLSLASHKIPGNNGLRDMVTLLKWVQRNAKVFGGDPKRVTILGESAGAASVHLLMLSRASKGLFNKAIIMSGTAIPNFYSSSPIYAKYISDMFLGELGLNSTELTSDEIHQTLTELPLDDIMRANDVVQYRAGLTSFVPVVEKEGHDYTRIIDDDPITLINQGVGKDIPLLMGFNKDEGEYFKWIITIYNIVDRYKSNPAVILSPRLAYELPPQEASAKGIFVGKRYFDGEPTVDGFVKSVTDIYFQYPMIKLAQWRILLNSAPTYFYEFSYESDFSITKRANWLSYKGTAHVEDLTYVFHTTTFLGSQVSVPPKTRDDQMRDWMSTLFSNYVRCNNPTCNKRDDPRWPPINEEELMFQVIKEPNVYKMSSLPKQLEDMVEFHDGVDDQVRMQSEILKEQKKKHSMYQ

Summary

Similarity
Belongs to the type-B carboxylesterase/lipase family.
Pfam
PF00135   COesterase        + More
PF00246   Peptidase_M14
Interpro
IPR002018   CarbesteraseB        + More
IPR029058   AB_hydrolase       
IPR019826   Carboxylesterase_B_AS       
IPR019819   Carboxylesterase_B_CS       
IPR002168   Lipase_GDXG_HIS_AS       
IPR008969   CarboxyPept-like_regulatory       
IPR000834   Peptidase_M14       
SUPFAM
SSF53474   SSF53474        + More
SSF49464   SSF49464       
Gene 3D
PDB
2FJ0     E-value=1.04847e-128,     Score=1182

Ontologies

Topology

SignalP
Position:   1 - 17,         Likelihood:  0.933011
 
 
Length:
1073
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.1068
Exp number, first 60 AAs:
0.02084
Total prob of N-in:
0.00187
outside
1  -  1073
 
 

Population Genetic Test Statistics

Pi
223.815181
Theta
170.664725
Tajima's D
1.109655
CLR
0.169576
CSRT
0.687215639218039
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
25860555 EAIEQSR 100.00 0.002
27102218 VFGGDPDKVTVIGESAGAASVNIIMMSDAAK 100.00 0.010
24093152 FADYTPEEQQSR 100.00 0.010
27102218 TMVEFCDSVDDQVR 100.00 0.010
28556443 LGELQEYVR 100.00 0.021
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号