SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14916  Validated by peptides from experiments
Pre Gene Modal
BGIBMGA000776
Annotation
PREDICTED:_juvenile_hormone_esterase-like_isoform_X1_[Bombyx_mori]
Full name
Carboxylic ester hydrolase       + More
Juvenile hormone esterase      
Location in the cell
PlasmaMembrane   Reliability : 2.366
 

Sequence

CDS
ATGAGCCACTACACCACGGCTTTACTTGGTCTGCTTTTCGTCGTTTGTGGTGTATTCTGCAATGAGCAATGTGGGGTGTTGGTGAACATCGACTCTGGGCCTGTGTGCGGGAAGGTGGAGATTGCCGAAAACAGCACCAAATACTACAGCTTCCAGGGAATACCGTACGGGAAACCACCCACAGGAGCCAGGAGATTTGCAGAATTAGAGCCTGTGGAGCCATGGACTGATCTATTATATGCTTACGAAGAAGGACCAGCTTGTCCTTCGAGAGACATTATCTATGGCAGCATTACTATCAAGGCCAAGGGCGTCAGCGAAGACTGTATCTATGCCAATGTCTTTGTGCCCGCGACCGCTCAACTAAACACCGATGAACTCAGCGAAGTTAGTTTACTGCCCATACTGGTGAACATCCACGGGGGCGCCTTCAATGCAGGGTCGGGCAATCGGGATTTGCACGGACCAGAGTTATTGATGGTGAAAGATGTTATTGTGATCAATTTTAATTACAGATTGGCGGTTTTCGGATTTTTATCCCTTGCTTCGGATAAGATTCCGGGTAACAACGGTCTGCGCGACATGGTGACACTGCTACGCTGGGTTCAAAGAAACGCACGAGTCTTTGGGGGGGATCCTGATAAAGTGACAGTGCTCGGAGAGAGCGCTGGGGCTGCATCGGTTAATCTTTTAATGATGTCTGATGCCGCTAAGGGACTTTTCAACAAAGCCATAATAATGAGTGGTACAGCTTTTCCAAGCTTCTACAGCACCTCTGCGGTATACGCCAAATATGTCGCCGATTTTTTCCTCGGACAATTGGGTGTTAACTCTACTGATCCTGATGAAATTCATCAGATTTTAATTGAACTACCTTTAGAAGACATCATGAAGGCCAATGACGTGGTGCAATACAATTCAGGTATAGCCTCGTTCGTGCCGGTAGTGGAAATTGAAGGTCATAACTATACGAGGATTATTGATGACGACCCCATAGTTCTCATAGCAGAGGGTCGGGGTAAGGATATTCCCTTACTAATGGGTTTCAATCAGAATGAAGGAGAAACATTCAGGTGGCTTTTAACCATTATGGATGCGTTAACTCGTTACAAAACTAATCCGGCTGCTATATTATCACCGAGATTAGCTTACGAGTTATCGACAGAAGAAGCTTTGGCTAAAGCAGAATTAGTAGCGAAAAGATATTTTGACGGTGAAGTGACTATGGATGGTTTCATAAAAAGTGTAACAGATCAATTGTTCCAATATCCTATTATAAAACTAGCACAATGGAGAACATTGCTGAATTCAGCACCGACTTTTCTGTACGTATTTTCGTATCAGGGTGACATCAGCATTATAAAGAGATCTAACTGGTTAAGTTACAACGGTACAGGTCATGTCGAGGATCTGACGTACGTGTTTCGCACCACCACATTTCTCCGCGATCACGTATCGATTCCTCCTCAGACTAGGGATGATCACATGAGGGACTGGATGTCCACACTGTTCAGTAACTACGTAAAATGCAACAATCCGACATGCACAGAGTCTGATGATCCTCAGTGGCCACCGATCAATCAAACAGAGTTAATGTATCAACTCATTAAAGAGCCCAACGTCTACAGCCTGTCCGCTCTGTCTGATGAGTTCAAGACAATGGTTGAGTTCTGCGATAGCGTGGATGACCAAGTCAGGACACGTTCAGAGACTTTCAAGCAGCAACACGGTTAA
Protein
MSHYTTALLGLLFVVCGVFCNEQCGVLVNIDSGPVCGKVEIAENSTKYYSFQGIPYGKPPTGARRFAELEPVEPWTDLLYAYEEGPACPSRDIIYGSITIKAKGVSEDCIYANVFVPATAQLNTDELSEVSLLPILVNIHGGAFNAGSGNRDLHGPELLMVKDVIVINFNYRLAVFGFLSLASDKIPGNNGLRDMVTLLRWVQRNARVFGGDPDKVTVLGESAGAASVNLLMMSDAAKGLFNKAIIMSGTAFPSFYSTSAVYAKYVADFFLGQLGVNSTDPDEIHQILIELPLEDIMKANDVVQYNSGIASFVPVVEIEGHNYTRIIDDDPIVLIAEGRGKDIPLLMGFNQNEGETFRWLLTIMDALTRYKTNPAAILSPRLAYELSTEEALAKAELVAKRYFDGEVTMDGFIKSVTDQLFQYPIIKLAQWRTLLNSAPTFLYVFSYQGDISIIKRSNWLSYNGTGHVEDLTYVFRTTTFLRDHVSIPPQTRDDHMRDWMSTLFSNYVKCNNPTCTESDDPQWPPINQTELMYQLIKEPNVYSLSALSDEFKTMVEFCDSVDDQVRTRSETFKQQHG

Summary

Description
JH esterase plays a crucial role in the decrease of JH activity in lepidopteran insects, by hydrolyzing the methyl ester of JH. It is also involved in the transport of JH.
Catalytic Activity
H2O + juvenile hormone I = H(+) + juvenile hormone I carboxylate + methanol
H2O + juvenile hormone III = H(+) + juvenile hormone III carboxylate + methanol
Similarity
Belongs to the type-B carboxylesterase/lipase family.
Keywords
Direct protein sequencing   Disulfide bond   Glycoprotein   Hydrolase   Serine esterase   Signal  
Feature
chain  Carboxylic ester hydrolase
EC Number
3.1.1.-
3.1.1.59
EMBL
BABH01034170    BABH01034171    AB543061    BAJ11978.1    BABH01034174    FJ652458    + More
ACV60242.1    KZ149945    PZC76778.1    AF327882    AAG42021.2    KX015865    ARM65394.1    PZC76779.1    HQ588158    ADU25009.1    AF287267    AAL55240.1    BABH01034175    AY489292    AAR37335.1    KY021876    AQY62765.1    EU178813    ABW24129.1    AF037197    AAB96654.1    AF037196    AAC38822.1    J04955    JQ901384    AGB93712.1    PZC76780.1    HM588760    AEB77712.1    KY938807    ASA46448.1    FJ875998    ACO81854.2    AGBW02014918    OWR40861.1    JTDY01001282    KOB74302.1    KM926341    AJR27471.1    KQ460205    KPJ17063.1    KU375426    APD13868.1    KQ459604    KPI92141.1    LC012033    BAR88201.1    JX866744    AGS49148.1    EU523701    ACB12192.1    ADU25010.1    FJ652445    ACV60229.1    ODYU01007337    SOQ50016.1    ODYU01008725    SOQ52573.1    ODYU01010342    SOQ55377.1    FJ997319    ADF43484.1    HQ588155    ADU25006.1    AF153367    AAD34172.1    KP938886    AKS40367.1    KOB74303.1    KU215370    AMB19664.1    RSAL01000057    RVE49776.1    KX015857    ARM65386.1    RVE49777.1    GEYN01000073    JAV02056.1    GEYN01000067    JAV02062.1    KY021831    AQY62720.1    KOB74304.1    GEYN01000059    JAV02070.1    GEYN01000072    JAV02057.1    KY021830    AQY62719.1    GEYN01000063    JAV02066.1    KY021836    AQY62725.1    GEYN01000064    JAV02065.1    KY021861    AQY62750.1    KU215371    AMB19665.1    KQ971352    KYB26709.1    ODYU01000269    SOQ34744.1    KP859354    AKZ17664.1    KQ459592    KPI96776.1    GALX01003004    JAB65462.1    HQ122616    AEL33699.1    AJ845190    CAH60167.1    KP938875    AKS40356.1    AJ845189    CAH60166.1    EU255790    ABX46627.1    GCVX01000034    JAI18196.1    MF687633    ATJ44559.1    BABH01033219    MF687564    ATJ44490.1    KU375427    APD13869.1    KQ460845    KPJ12017.1    KU215373    AMB19667.1    FJ652446    ACV60230.1    KX015868    ARM65397.1    NWSH01003954    PCG65624.1    NEVH01002552    PNF42157.1    PNF42088.1    RSAL01000139    RVE46156.1    ODYU01012558    SOQ58953.1    GQ180944    ACT53736.1    KP001159    AJN91204.1    KF960791    AII21993.1    KM234964    AIY68378.1    ODYU01001848    SOQ38619.1    GCVX01000032    JAI18198.1    KY021856    AQY62745.1    DS235093    EEB11822.1    PNF42132.1    JN019808    AEJ18172.1    KP938878    AKS40359.1    KU375439    APD13881.1    PNF42130.1   
Pfam
PF00135   COesterase        + More
PF00083   Sugar_tr
Interpro
IPR002018   CarbesteraseB        + More
IPR029058   AB_hydrolase       
IPR019826   Carboxylesterase_B_AS       
IPR019819   Carboxylesterase_B_CS       
IPR005829   Sugar_transporter_CS       
IPR020846   MFS_dom       
IPR036259   MFS_trans_sf       
IPR005828   MFS_sugar_transport-like       
IPR000997   Cholinesterase       
IPR002168   Lipase_GDXG_HIS_AS       
SUPFAM
SSF53474   SSF53474        + More
SSF103473   SSF103473       
Gene 3D
PDB
2FJ0     E-value=1.18221e-140,     Score=1283

Ontologies

Topology

SignalP
Position:   1 - 20,         Likelihood:  0.992363
 
 
Length:
577
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
5.40696999999999
Exp number, first 60 AAs:
4.38823
Total prob of N-in:
0.18169
outside
1  -  577
 
 

Population Genetic Test Statistics

Pi
235.751416
Theta
182.337678
Tajima's D
1.014156
CLR
0.07031
CSRT
0.666916654167292
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Peptides ×
Source Sequence Identity Evalue
27102218 IAVFGFISIASDK 100.00 3e-07
24093152 YYPIYQEIIVPR 100.00 1e-06
27102218 FAEIEPVEPWTDIIYAYEEGPACPSR 100.00 1e-06
28467696 YYSAEDWKK 100.00 1e-06
27102218 YYSFQGIPYGKPPTGAR 100.00 6e-04
24093152 TMFDTAMQAAIDK 100.00 8e-04
27102218 YFDGEVTMDGFIK 100.00 8e-04
24093152 YFDGEPTIDGIAK 100.00 0.005
27102218 AEIVAK 100.00 0.005
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号