SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14839
Annotation
AF461149_1_transposase_[Bombyx_mori]
Location in the cell
Mitochondrial   Reliability : 1.741 Nuclear   Reliability : 2.275
 

Sequence

CDS
ATGGAGTGGACGCTTAAAGAAGACCGTGTTGCAGTTATTGCGTTGCATCGTTGCGGTTACGCGCCAATTCAAATTTTTAACATACTGAAAAATTTTAATATAACCAAAAGATTCGTTTATCGTACCATCAAACGATACAATGAAGACTCTAGTGTAGATGACAGGTCAAGAAGTGGTCGCCCTCGGTCTGTTAGGACTCTAGCAGTGATAAAAGTTGTGAAGGCGCGAATTCAAAGAAATCCCAAACCCCTGACGAACCTTGTGGAACCTGTTTCTCATATCATGTTCAATAACAGGCACTGGGTATTCCAACAAGATTCGGCGCCAGCTCATAGAGCGAAGAGCACACAAGACTGGCTGGCGACGCGTGAAATCGACTTCATCCGGCACGAAGACTGGCCCTCCTCCAGTCCAGATTTGAATCCGGTAGATTACAAGATATGGCAACACTTGGAGGAAAAGGCGTGCTCAAAGCCTCATCCCAATTTGGAGTCACTCAAGACATCCTTGATTAAGGCAGCTGCCGATATTGACATGGACCTCGTTCGTGCTGCGATAGACGACTGGCCGCGCAGATTGAAGGCCTGTATTCAAAATCACGGAGGTCATTTTGAATAA
Protein
MEWTLKEDRVAVIALHRCGYAPIQIFNILKNFNITKRFVYRTIKRYNEDSSVDDRSRSGRPRSVRTLAVIKVVKARIQRNPKPLTNLVEPVSHIMFNNRHWVFQQDSAPAHRAKSTQDWLATREIDFIRHEDWPSSSPDLNPVDYKIWQHLEEKACSKPHPNLESLKTSLIKAAADIDMDLVRAAIDDWPRRLKACIQNHGGHFE

Summary

Pfam
PF13358   DDE_3
Interpro
IPR038717   Tc1-like_DDE_dom        + More
IPR009057   Homeobox-like_sf       
SUPFAM
SSF46689   SSF46689       
PDB
5CR4     E-value=6.14228e-09,     Score=141

Ontologies

Topology

Length:
205
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
1.96801
Exp number, first 60 AAs:
1.96768
Total prob of N-in:
0.14633
outside
1  -  205
 
 

Population Genetic Test Statistics

Pi
121.467847
Theta
63.421624
Tajima's D
1.63673
CLR
2.91756
CSRT
0.818859057047148
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号