SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14831
Annotation
PREDICTED:_uncharacterized_protein_LOC106138993_[Amyelois_transitella]
Location in the cell
Nuclear   Reliability : 3.397
 

Sequence

CDS
ATGCCTCGGAAGGGTGCTAAAGAAGACGAAGAATGCTTTGCTGAACCTGCTCCACAAATTTCCTTCTGCGAATTAGAAAAATCTATGACTGCATTTTCTGGTGACGATGCATACGGCGTGGATACCTTTATAAAGGATTTTGAAGATATCGCTAATCTCATGCAATGGACGGGCATTGAAAAACTGATCTACGCAAAAAGGCTTTTGAAGGGGACAGCAAAATTGTTCCTGAGATCTTTGACTAGTACGACTACATGGGAACTCTTGAAAACGGGATTAAAAGAGGAATTTGGACTACATCTGAACAGCGCAGCCATTCACAAGACCATATCAAATAGGAAGATGAAACCAGGTGAAACCTACCAACAATATTTTTTGCAACTCAAAGAACTAGCAGTACTCGGAAATATTGAAGATGACGCCCTAATGGAATACATCATTGATGGCATCCCTGACAATGAAATGAATAAAACTATACTATATGGGGCTTCCAACATTAAAGAATTTAGGAAAAAACTTGATTTATATGCTGAAATAAAGAAGAAATGTCGAACGTCAAACAAAGCTTATAATCAATCAACAACATCCAAGCCTACAACATCTGGATGGAAGAAACCATTACCTAAGAAGAGATGTTTCAACTGCGGAGACCTAGATCATGAATCTTCAGGCTGCTCTAAAGGAATAAAGTGCTTCCGTTGTAATGACTTTGGTCATAAGTCAACTGACTGTCCCAAAAATATAAAGAAGACTCTAGAAATAAAATGTAACAAGGAGAATGATAGCCAAGCACCCTACAAAGAAGTTTTGATCAATAATGTTATGGTAAAATCACTTATTGACACTGGCAGTGATGTGAACCTAATGAATGAATCTACATTTACTCAAATACATGGCGACACTTGTAACTACCATCCTGATTTAGTACAAAGCCTGACAGGCATTGGTGACTGTGAGGTACATACAAGAGGCTCATGTACTCCAAGAATTGAGATTGATGGTTGCCAATGTGAAGCAACGTTCTATATAATCGAAGATGACAAAATACCAGTTGATGTAATAATAGGGAACCCAATATTACAGGACATAGAACTCAGTTTTAAGTCTGGTGTTATTTCTGCTAAAAGAATTTTACAACTCACAATGTTAGAGGATCAGGCTGAGGAACCAATGATTATAGGAAATTTCAAATATAAAGATCAGATTGAGAAAATACTGACAGAATATGACCCTGGAAAATGTTGTAAATAA
Protein
MPRKGAKEDEECFAEPAPQISFCELEKSMTAFSGDDAYGVDTFIKDFEDIANLMQWTGIEKLIYAKRLLKGTAKLFLRSLTSTTTWELLKTGLKEEFGLHLNSAAIHKTISNRKMKPGETYQQYFLQLKELAVLGNIEDDALMEYIIDGIPDNEMNKTILYGASNIKEFRKKLDLYAEIKKKCRTSNKAYNQSTTSKPTTSGWKKPLPKKRCFNCGDLDHESSGCSKGIKCFRCNDFGHKSTDCPKNIKKTLEIKCNKENDSQAPYKEVLINNVMVKSLIDTGSDVNLMNESTFTQIHGDTCNYHPDLVQSLTGIGDCEVHTRGSCTPRIEIDGCQCEATFYIIEDDKIPVDVIIGNPILQDIELSFKSGVISAKRILQLTMLEDQAEEPMIIGNFKYKDQIEKILTEYDPGKCCK

Summary

EMBL
LBMM01010976    KMQ87102.1    GBBI01004613    JAC14099.1    LBMM01004258    KMQ92652.1    + More
GBBI01004551    JAC14161.1    GBBI01004550    JAC14162.1    ABLF02014660    ABLF02042774    GBBI01004549    JAC14163.1    GAMC01016174    JAB90381.1    GDHF01023027    JAI29287.1    GBXI01005773    JAD08519.1    GBBI01004477    JAC14235.1    ABLF02005127    ABLF02005129    ABLF02007401    ABLF02011059    GBXI01006173    JAD08119.1    QOIP01000004    RLU23736.1    GAMC01020207    JAB86348.1    GAMC01007326    JAB99229.1    GBXI01004632    JAD09660.1    AGBW02009151    OWR51557.1    ABLF02005846    KQ980852    KYN12192.1    GDHF01031400    JAI20914.1    CH478509    EJY58114.1    AJWK01016333    GFDF01007768    JAV06316.1    KQ971327    KYB28419.1    GDHF01019733    JAI32581.1    AJWK01024440    GGFM01002109    MBW22860.1    KQ977161    KYN05238.1    GAMC01015907    JAB90648.1    GAKP01019383    JAC39569.1    GGFM01002486    MBW23237.1    GEHC01000930    JAV46715.1    GFTR01008753    JAW07673.1    GBYB01008203    JAG77970.1    LBMM01018094    KMQ83877.1    HACL01000135    CFW94429.1    GBGD01000341    JAC88548.1    AAAB01008984    GGFJ01002513    MBW51654.1    GGFJ01002514    MBW51655.1    GL764261    EFZ18057.1    GGFK01005990    MBW39311.1    GAMC01002792    JAC03764.1    KQ980436    KYN16061.1    GGFJ01002620    MBW51761.1    GGFJ01002621    MBW51762.1    GGFJ01001974    MBW51115.1    KQ977505    KYN02276.1    GGFJ01002579    MBW51720.1    NWSH01001951    PCG69590.1    GGFJ01001952    MBW51093.1    Z27119    CAA81643.1    NNAY01005459    OXU16662.1    KQ971376    KYB25116.1    GBHO01014721    JAG28883.1    LBMM01011782    KMQ86633.1    GGFJ01005354    MBW54495.1   
Pfam
PF17919   RT_RNaseH_2        + More
PF17921   Integrase_H2C2
PF00665   rve
PF00078   RVT_1
PF00098   zf-CCHC
PF02037   SAP
PF17917   RT_RNaseH
PF03732   Retrotrans_gag
PF00067   p450
PF00077   RVP
PF14392   zf-CCHC_4
PF09668   Asp_protease
PF12017   Tnp_P_element
Interpro
IPR001878   Znf_CCHC        + More
IPR012337   RNaseH-like_sf       
IPR036875   Znf_CCHC_sf       
IPR036361   SAP_dom_sf       
IPR001969   Aspartic_peptidase_AS       
IPR001995   Peptidase_A2_cat       
IPR041577   RT_RNaseH_2       
IPR001584   Integrase_cat-core       
IPR000477   RT_dom       
IPR003034   SAP_dom       
IPR036397   RNaseH_sf       
IPR041588   Integrase_H2C2       
IPR021109   Peptidase_aspartic_dom_sf       
IPR041373   RT_RNaseH       
IPR005162   Retrotrans_gag_dom       
IPR002401   Cyt_P450_E_grp-I       
IPR001128   Cyt_P450       
IPR017972   Cyt_P450_CS       
IPR036396   Cyt_P450_sf       
IPR018061   Retropepsins       
IPR025836   Zn_knuckle_CX2CX4HX4C       
IPR019103   Peptidase_aspartic_DDI1-type       
IPR034145   RP_RTVL-H-like       
IPR021896   Transposase_37       
SUPFAM
SSF53098   SSF53098        + More
SSF57756   SSF57756       
SSF68906   SSF68906       
SSF50630   SSF50630       
SSF48264   SSF48264       
PDB
2LLI     E-value=0.0038442,     Score=95

Ontologies

Topology

Length:
416
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00159
Exp number, first 60 AAs:
6e-05
Total prob of N-in:
0.01321
outside
1  -  416
 
 

Population Genetic Test Statistics

Pi
32.435705
Theta
21.656573
Tajima's D
3.614564
CLR
41.722675
CSRT
0.995400229988501
Interpretation
Possibly Balancing Selection

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号