SGID Silkworm Genome Informatics Database
Gene
KWMTBOMO14803
Annotation
PREDICTED:_uncharacterized_protein_LOC106106229_isoform_X3_[Papilio_polytes]
Location in the cell
Nuclear   Reliability : 3.698
 

Sequence

CDS
ATGGCGGAGAGCAAAAACGACGATAGCAAGAATTTATTTTACACGATGGACGCTGTGCCAAAGTTCACGGGTGATGACATCACGTACTCTTCTGCGAAGTGGACACAAGATCTCGACGATAATGCCGATATATTTGGGTGGAGCCAGCAGCAGAAACTCATTATAGCGCGACGATGTTTAGCTGGAACAGCAGAATTATGGCTAAAAAGCGAAAAAACTTTCAGAAGTTACGAAGAACTAAAAGTGGCTTTGATGAAGGAATTCCCTGAGGTGATAAACAGTAAACAAATGCATGAGACAATGAGCAGACGGAAAAAACAACCCAATGAGTCGTTTTATCAATATATGCTCGTAATGAAAGAACTCGGAAAAAGAGCTAAGTTTCCGGATTACGTCGCGATTCAGTATATAATCGACGGAATATCTGACTATGAATCTAACAAGTTGTTATTCTACGGGGTAACGTCGTATTCTGTGCTCAAGGAGAAATTAGTATTATATGAAAGTTTCAAAGAGAAGTCCAAAAAAAGTGTTGATACCATGAGACGAGGTCAGCGAGACACGGCGGTAATGCCTAGACAGGTTCATCGATGTTACAATTGTGGTGAAAGAGGGCACCTATCTAGTTCCTGCCGCAGAGGTATCAAATGCTTCAAGTGCAACGGGTTCGGGCACAAGGGTACGGAGTGCCGCGCATCACAAGGTATGGAAGCTAAAAAAGCATCAAATAATTATTATGGAGGAGGTGATGAACAAGATCGGCGATCTATGTTTGTTCGACAGCAGGAGGACGACGAGAAGAACGAGAACGAACTATACGAACGTGAGCAATGCGATTTAAAAGAGCAATAG
Protein
MAESKNDDSKNLFYTMDAVPKFTGDDITYSSAKWTQDLDDNADIFGWSQQQKLIIARRCLAGTAELWLKSEKTFRSYEELKVALMKEFPEVINSKQMHETMSRRKKQPNESFYQYMLVMKELGKRAKFPDYVAIQYIIDGISDYESNKLLFYGVTSYSVLKEKLVLYESFKEKSKKSVDTMRRGQRDTAVMPRQVHRCYNCGERGHLSSSCRRGIKCFKCNGFGHKGTECRASQGMEAKKASNNYYGGGDEQDRRSMFVRQQEDDEKNENELYEREQCDLKEQ

Summary

EMBL
NWSH01000799    PCG74125.1    NWSH01000198    PCG78490.1    NWSH01001586    PCG70783.1    + More
ODYU01001505    SOQ37806.1    NWSH01000337    PCG77293.1    NWSH01004261    PCG65293.1    NWSH01002797    PCG67520.1    NWSH01002403    PCG68369.1    NWSH01002225    PCG68884.1    LBMM01010976    KMQ87102.1    GBBI01004613    JAC14099.1    GBBI01004551    JAC14161.1    GBBI01004550    JAC14162.1    LBMM01004258    KMQ92652.1    GBBI01004549    JAC14163.1    LBMM01009423    KMQ88147.1    GBXI01005773    JAD08519.1    ACPB03028153    QOIP01000004    RLU23736.1    GAMC01016174    JAB90381.1    GDHF01023027    JAI29287.1    GBXI01006173    JAD08119.1    CH478509    EJY58114.1    GAKP01001187    JAC57765.1    KQ972211    EFA11958.2    ABLF02014660    ABLF02042774    GGFJ01002513    MBW51654.1    GGFJ01002514    MBW51655.1    GDHF01031400    JAI20914.1    GFDF01007768    JAV06316.1    AGBW02009151    OWR51557.1    ACPB03006966    KQ971327    KYB28419.1    GBXI01004632    JAD09660.1    GAMC01020207    JAB86348.1    ABLF02005127    ABLF02005129    ABLF02007401    GBBI01004477    JAC14235.1    GAMC01007326    JAB99229.1    AJWK01024440    GGFJ01002621    MBW51762.1    GGFJ01002620    MBW51761.1    GGFJ01001974    MBW51115.1    AJWK01016333    GGFJ01002579    MBW51720.1    KQ971355    KYB26210.1    GAMC01002792    JAC03764.1    GBGD01000341    JAC88548.1    GAKP01019383    JAC39569.1    GGFJ01001952    MBW51093.1    GFTR01008753    JAW07673.1    ABLF02005846    GDHF01019733    JAI32581.1    GGFM01002109    MBW22860.1    ABLF02011059    LBMM01018094    KMQ83877.1    GGFK01005990    MBW39311.1    HACL01000135    CFW94429.1    AAAB01008984    GGFM01002486    MBW23237.1    GDHF01031998    JAI20316.1    KQ980852    KYN12192.1    GAMC01015907    JAB90648.1    GEHC01000930    JAV46715.1    AJWK01011772    ACPB03027146    GBHO01014721    JAG28883.1   
Pfam
PF00098   zf-CCHC        + More
PF00077   RVP
PF00078   RVT_1
PF00665   rve
PF17921   Integrase_H2C2
PF17919   RT_RNaseH_2
PF02037   SAP
PF17917   RT_RNaseH
PF03732   Retrotrans_gag
PF00067   p450
PF14392   zf-CCHC_4
PF09668   Asp_protease
Interpro
IPR001878   Znf_CCHC        + More
IPR036875   Znf_CCHC_sf       
IPR021109   Peptidase_aspartic_dom_sf       
IPR001969   Aspartic_peptidase_AS       
IPR001995   Peptidase_A2_cat       
IPR000477   RT_dom       
IPR018061   Retropepsins       
IPR041577   RT_RNaseH_2       
IPR001584   Integrase_cat-core       
IPR012337   RNaseH-like_sf       
IPR036397   RNaseH_sf       
IPR041588   Integrase_H2C2       
IPR036361   SAP_dom_sf       
IPR003034   SAP_dom       
IPR041373   RT_RNaseH       
IPR005162   Retrotrans_gag_dom       
IPR002401   Cyt_P450_E_grp-I       
IPR001128   Cyt_P450       
IPR017972   Cyt_P450_CS       
IPR036396   Cyt_P450_sf       
IPR025836   Zn_knuckle_CX2CX4HX4C       
IPR019103   Peptidase_aspartic_DDI1-type       
SUPFAM
SSF57756   SSF57756        + More
SSF50630   SSF50630       
SSF53098   SSF53098       
SSF68906   SSF68906       
SSF48264   SSF48264       
PDB
2BL6     E-value=3.10498e-05,     Score=111

Ontologies

Topology

Length:
283
Number of predicted TMHs:
0
Exp number of AAs in TMHs:
0.00224
Exp number, first 60 AAs:
0.00033
Total prob of N-in:
0.10357
outside
1  -  283
 
 

Population Genetic Test Statistics

Pi
311.100633
Theta
189.17493
Tajima's D
1.962552
CLR
12.620595
CSRT
0.88145592720364
Interpretation
Uncertain

Multiple alignment of Orthologues

 
 

Gene Tree

 
 
Copyright@ 2018-2023    Any Comments and suggestions mail to:zhuzl@cqu.edu.cn   渝ICP备19006517号